From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 7A18AF321B for <9fans@9fans.net>; Wed, 14 Oct 2020 14:10:43 -0400 (EDT) (envelope-from 01000175284e9c74-bf3cc22a-78f0-4086-a907-e540fbeab1a9-000000@amazonses.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id A2E5CDF7247; Wed, 14 Oct 2020 14:10:43 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1602699043; b=nr9+IrmK9lKHfo8gWKkrabwKXPdD7FJwTqXE1wyzj0Lj6cM42I 3VVDgJ6lQneIg9IZly9/2ej9rrbN1Cr6OT/D1r+VESlgwVQug/e7l3oKCvK9NsCn BVs9x5MdjZLgW0zcNWuFK57aR86KheY2UEnu/2YJ7Feq9SScT5RbomWvpFmDcw2X cUiCcmbimYPKsau/KMaR5Kj9KpxuXJeevxgHrpww+cPlfqzVHq1kcbvPurH1QhFd f+xNLvOZMRfhOuKfUfxy6oTPsevaYsNBYNLpM52/yY1WVja8Itxnb5L4z375Xjn6 XCTL7IIyDAHqt5dnvrCpkHvsj3OTC//axgrA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:subject :message-id:date:to; s=arcseal; t=1602699043; bh=59UdBldYqNxnARm 6jv7DGtUK1R3OWSxUho2akVe2I7s=; b=jOvlll8VBWPElynu+8gcsoLBSPZEhpe N9Z6gH9W7jSbx92kN96AFqsqqNfUETCGBM4EtRV/5x4Qc9H0vk3oj9wI6/fLxYnQ 2/1mNb0ZZpYG33xSQuKYkuHQxvSFQ0/bbSyc6hYUYwuwU3RJsP1jJI/KxYMEAJrG r3fbZwLZjo62/7Cfk69BkVcFy4lc5Py9Xmo72CvkpZ2gBVek1Iaz05fPFW7Pa1KB 5P5e/4ijoT4lHObd57KWeTYgL3WVTspn61MDIElOUvJ/Xuv0MVDN6/CLGeri5jzf mb+TuAfOGi4fdXbd1I56LmjCfhEW/RlBiTnPGwq8FpOmPw1lF7eHG+g== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC none); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=ctukd3Cx header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.11.73 (a11-73.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 01000175284e9c74-bf3cc22a-78f0-4086-a907-e540fbeab1a9-000000@amazonses.com smtp.helo=a11-73.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a11-73.smtp-out.amazonses.com policy.ptr=a11-73.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx3.crocker.rcimx.net,mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC none); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=ctukd3Cx header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.11.73 (a11-73.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 01000175284e9c74-bf3cc22a-78f0-4086-a907-e540fbeab1a9-000000@amazonses.com smtp.helo=a11-73.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a11-73.smtp-out.amazonses.com policy.ptr=a11-73.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx3.crocker.rcimx.net,mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedujedriedugdduvdduucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhtggguf fkfffvofesrgdtreerhhdtjeenucfhrhhomhepofgrtghkucghrghllhgrtggvuceomhgr tghksgifsehmrghpihhnthgvrhhnvghtrdgtohhmqeenucggtffrrghtthgvrhhnpefhud ejtdffieeigeeikeekfffghfegleffvdfhheekleduhefhuedvtefgkedthfenucfkphep heegrddvgedtrdduuddrjeefnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpe hinhgvthepheegrddvgedtrdduuddrjeefpdhhvghloheprgduuddqjeefrdhsmhhtphdq ohhuthdrrghmrgiiohhnshgvshdrtghomhdpmhgrihhlfhhrohhmpeeotddutddttdduje ehvdekgegvlegtjeegqdgsfheftggtvddvrgdqjeekfhdtqdegtdekiedqrgeltdejqdgv heegtdhfsggvrggsudgrledqtddttddttddtsegrmhgriihonhhsvghsrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (amazonses.com: 54.240.11.73 is authorized to use '01000175284e9c74-bf3cc22a-78f0-4086-a907-e540fbeab1a9-000000@amazonses.com' in 'mfrom' identity (mechanism 'ip4:54.240.0.0/18' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="01000175284e9c74-bf3cc22a-78f0-4086-a907-e540fbeab1a9-000000@amazonses.com"; helo=a11-73.smtp-out.amazonses.com; client-ip=54.240.11.73 Received: from a11-73.smtp-out.amazonses.com (a11-73.smtp-out.amazonses.com [54.240.11.73]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 14 Oct 2020 14:10:43 -0400 (EDT) (envelope-from 01000175284e9c74-bf3cc22a-78f0-4086-a907-e540fbeab1a9-000000@amazonses.com) DKIM-Signature: v=1; a=rsa-sha256; q=dns/txt; c=relaxed/simple; s=224i4yxa5dv7c2xz3womw6peuasteono; d=amazonses.com; t=1602699042; h=From:Content-Type:Mime-Version:Subject:Message-Id:Date:To:Feedback-ID; bh=uU1Sl9RootOrykPMQT7fSkEFNpoMQ3D5TzbpnjT1gWU=; b=ctukd3CxXICFejyTjZjxcnGyqiNHnED8oH9JukJs9+sL42028iAWHPFztRwJHa20 8Poilm1TqKOBALz0IBv1P6oMuFb3sbVgnFJKQRJCd5nSNPJJRw/J4a824D43BGG2LZT bfmkkxJcZNr5NMU92vjh2OmJVAkNhoaThe0CzitQ= X-Default-Received-SPF: pass (skip=loggedin (res=PASS)) x-ip-name=50.202.122.66; envelope-from=; From: Mack Wallace Content-Type: multipart/alternative; boundary="Apple-Mail=_681900A5-1E99-474A-9A6B-C24F14CD52A4" Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.1\)) Subject: Couple of questions - not sure where best to ask Message-ID: <01000175284e9c74-bf3cc22a-78f0-4086-a907-e540fbeab1a9-000000@email.amazonses.com> Date: Wed, 14 Oct 2020 18:10:42 +0000 To: 9fans@9fans.net X-Mailer: Apple Mail (2.3608.120.23.2.1) X-Authenticated-User: mackbw@mapinternet.com X-SES-Outgoing: 2020.10.14-54.240.11.73 Feedback-ID: 1.us-east-1.X+xhoL9JiEQ8K0gzGjV36WZnSewOzOs8YCWuakKsLBY=:AmazonSES Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 961cbfea-0e48-11eb-9f21-cfa82aeed915 --Apple-Mail=_681900A5-1E99-474A-9A6B-C24F14CD52A4 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset=utf-8 Hi all, I am trying to set up a super simple wiki that can be used by either the = web, or bulk editing through acme. Wikifs seems to address this quite = well. However i have run into a number of questions across various Plan = 9 platforms and am not sure if they all should be in separate e-mail = threads, or to different groups.=20 I have set up an experimental Plan9 cpu/file/auth server using 9front = and am able to 9fs and rcpu into the box from another 9front VM. I = understand that 9front has updated the authentication methods and = encryption which is why I can not access from a Labs version (or = plan9port) without some minor changes to the auth startup or open up the = old cpu port. I have a number of questions related to plan9port as well = as some more general Plan9/Acme/Wikifs questions. My general questions: Is it possible to secure wikifs through the auth = server? I am scratching for ideas, and certainly do not fully understand = all the mechanisms of Plan 9 - =46rom my guesses, Acme users could 9fs = into the server (requiring auth), and run wiki on their own machine. = However, I presume then there would be no management for write = collisions. If one can manage the Wikifs by file permissions, wouldn=E2=80= =99t that affect the ability of httpd to access the system? Another = question, although, I am in a position to try this - is it possible to = run multiple different Wikis, each as a different service? I know that = does not work so well for http serving, but I may want to keep a couple = separate wikis. I have been able to get into the wiki from Windows using acme-sac, but I = have had troubles with plan9port. Looking at plan9port, it looks like = wikifs access is not in the port. Is this something that would be = difficult to add? I seem to have more basic problems with plan9port from = my Mac. During the build there was an issue with 'ambiguous recipes for = macargv.o:.=E2=80=99 If I try to run the command to connect to a wiki, = or even just the term =E2=80=9CLocal srv,=E2=80=9D Acme crashes. For the = ambiguous recipes, I am not sure if I should write a post in the = plan9port-dev mail list, or in the plan9port github issues page. The = discussions in those seem more about development than how I may be = stupidly using the software. Thanks in advance to anyone willing to provide guidance. M. B. Wallace --Apple-Mail=_681900A5-1E99-474A-9A6B-C24F14CD52A4 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset=utf-8 Hi = all,

I am trying to = set up a super simple wiki that can be used by either the web, or bulk = editing through acme. Wikifs seems to address this quite well. However i = have run into a number of questions across various Plan 9 platforms and = am not sure if they all should be in separate e-mail threads, or to = different groups. 

I have set up an experimental Plan9 cpu/file/auth server = using 9front and am able to 9fs and rcpu into the box from another = 9front VM. I understand that 9front has updated the authentication = methods and encryption which is why I can not access from a Labs version = (or plan9port) without some minor changes to the auth startup or open up = the old cpu port. I have a number of questions related to plan9port as = well as some more general Plan9/Acme/Wikifs questions.

My general questions: Is = it possible to secure wikifs through the auth server? I am scratching = for ideas, and certainly do not fully understand all the mechanisms of = Plan 9 - =46rom my guesses, Acme users could 9fs into the server = (requiring auth), and run wiki on their own machine. However, I presume = then there would be no management for write collisions. If one can = manage the Wikifs by file permissions, wouldn=E2=80=99t that affect the = ability of httpd to access the system? Another question, although, I am = in a position to try this - is it possible to run multiple different = Wikis, each as a different service? I know that does not work so well = for http serving, but I may want to keep a couple separate = wikis.


I have been able to get into the wiki = from Windows using acme-sac, but I have had troubles with plan9port. = Looking at plan9port, it looks like wikifs access is not in the port. Is = this something that would be difficult to add? I seem to have more basic = problems with plan9port from my Mac. During the build there was an issue = with 'ambiguous recipes for macargv.o:.=E2=80=99 If I try to = run the command to connect to a wiki, or even just the = term =E2=80=9CLocal srv,=E2=80=9D Acme crashes. For the ambiguous = recipes, I am not sure if I should write a post in the plan9port-dev = mail list, or in the plan9port github issues page. The discussions in = those seem more about development than how I may be stupidly using the = software.

Thanks= in advance to anyone willing to provide guidance.

M. B. Wallace


= --Apple-Mail=_681900A5-1E99-474A-9A6B-C24F14CD52A4--