From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.9 required=5.0 tests=DKIM_SIGNED,DKIM_VALID, HTML_MESSAGE,MAILING_LIST_MULTI,RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H4, RCVD_IN_MSPIKE_WL,URIBL_SBL_A autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 21219 invoked from network); 14 Jan 2021 21:34:16 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 14 Jan 2021 21:34:16 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id CE90C34506 for ; Thu, 14 Jan 2021 16:34:11 -0500 (EST) (envelope-from bounce.mM908bcace3647dd9b93065b3f.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id CC46511BF81B; Thu, 14 Jan 2021 16:34:11 -0500 (EST) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=U6NC/jtI header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; spf=pass smtp.mailfrom=0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@amazonses.com smtp.helo=a11-124.smtp-out.amazonses.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:message-id:date :to:list-help:list-id:list-post:list-subscribe:reply-to:subject :content-transfer-encoding:list-unsubscribe; s=sysmsg-1; t= 1610660051; bh=IS80AePgOygPblbSgpwL0X6V2zpdDTH2cBD9nAosKb4=; b=b h8sVHypEKWFct5SqkR4p8BWqsxGUwWGvl8D2smNVyPxAaQ6klzMx6+mCY8QmzF7f tKldPdMoxMxNeWlxN1MF0AHZGS4eOEAyqW+ZUI5VEE8Q0LNRSWP0ZeT7LoDKVMtQ iFoKpjygzOqhLdTgSTRcn7ida4W+v0XfVhNP9siDcc= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1610660051; b=kRl73z1SlZ1lN24VjD6a4ng2Aw98UxVS4ubGWfbuKOAh0IxQWm 8hMKeWz0MJS+RA2Nd012IvI5XTJGPnJOZroFJLIo5LT3KwEFJBDZlFxZbjXDG/wt EWs+lR5rm0fLrs3dmoylZwlfAvE1clUN/AkaYzxkj6YkEAm5Db2Z9ExvA= Authentication-Results: topicbox.com; arc=pass; dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=U6NC/jtI header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; spf=pass smtp.mailfrom=0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@amazonses.com smtp.helo=a11-124.smtp-out.amazonses.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=U6NC/jtI header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.11.124 (a11-124.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@amazonses.com smtp.helo=a11-124.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a11-124.smtp-out.amazonses.com policy.ptr=a11-124.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net,mapinternet.com.mx3.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h=from :content-type:mime-version:message-id:date:to:list-help:list-id :list-post:list-subscribe:reply-to:subject :content-transfer-encoding:list-unsubscribe; s=dkim-1; bh=MMlHxk 0DYT+trE5/rwRegV8ko07VmQEdBEfIUJBOiEI=; b=T/GqhdS848x9+bis+FLscd KQ8Rwfm2OSYHQMJAEV04QNgD3C06+kJjJ91NpBCv4HfaAfrF3Hi+WWXqIultHlBj grL4JxokgqhwN0ocNGN+GfoLhPQ1sSLkGRZdbejocqJmQvsSgNimOFKkc2ZIm41n hapun/IbXBADndYKkH60E= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 810E9124C402 for <9fans@9fans.net>; Thu, 14 Jan 2021 16:34:01 -0500 (EST) (envelope-from 0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@amazonses.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 47B0D151403; Thu, 14 Jan 2021 16:34:01 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1610660041; b=OwEA0TksCFY2N+blWgXAAHc68PWrkMtyK1ZgXiNWq4+7vxrm/K Xuaes+xBGOM4jy+9RviNeF42708NFpm0pd/tI3vcMGn4W7qFITAahhXTKV0QoNrF APmXetcCmUgr+IR2O2blNhuC5tI4lsIOwK+Gcum48Dxepwcn7ZyCQiBkOvMgPpvC JeywXh8/hjp8a6BFiuw8DlEMk6FNTyH3Ax1yaQXcthkWYCkmtD7b6o6OmLVKXtgK TkAQ0ne977eCiWit6u3hgeCR9/5E10/lGvkJO6CPfX6yEHfXOwo7mKmS/Q9UGMks 9hJIvMrL2xTxQNUFOiB0And87ng2k/7ftpbA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:subject :message-id:date:to; s=arcseal; t=1610660041; bh=XSSnTzT5CkKCrYk LQ+rml1GJKhMgvK6xrDtjUTLRVxc=; b=w+HVI4tuUXmKTE7Ew1h+J0z7M1FggfO SB7T+EYlHiHTAaXUuwyqlL/w/1kc9QFJkZn2ELK3PIzy/XSf3eO21ihn9bfgxvT2 DjS/KF7h9oidcgOoaox+5zSHEkYEKmHOlQIXjm1pXz9m0IwEy9hhGV6tPzzGSut5 m1fMZuy0wQzyzV7KKrI69iezOZ4JQD5pThA1DQfGJONuueLgdBJNYhR3ejkju+4H iMEBT6iV2urqeKJz4hQuIDrNnt3hP4obmEouuoFfFEsgzefoKCMPVocL22DjjwMs f8PLB3QBrWtPYfhc+S2svqHI4ZTNH9zTe3HgynwDnNvPdYGJnwgODWQ== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=U6NC/jtI header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.11.124 (a11-124.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@amazonses.com smtp.helo=a11-124.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a11-124.smtp-out.amazonses.com policy.ptr=a11-124.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net,mapinternet.com.mx3.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrtddtgdduvdehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhtggguf fkfffvofesrgdtreerhhdtjeenucfhrhhomhepofgrtghkucghrghllhgrtggvuceomhgr tghksgifsehmrghpihhnthgvrhhnvghtrdgtohhmqeenucggtffrrghtthgvrhhnpefhud ejtdffieeigeeikeekfffghfegleffvdfhheekleduhefhuedvtefgkedthfenucfkphep heegrddvgedtrdduuddruddvgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmh epihhnvghtpeehgedrvdegtddruddurdduvdegpdhhvghloheprgduuddquddvgedrshhm thhpqdhouhhtrdgrmhgriihonhhsvghsrdgtohhmpdhmrghilhhfrhhomhepoedtuddttd dtudejjedtvdguudgtuggtuddqheelvdgusggtiedtqddtfeehjedqgedtuggvqdelugdt tddqieefuddtvggsugekfedtgegvqddttddttddttdesrghmrgiiohhnshgvshdrtghomh eq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (amazonses.com: 54.240.11.124 is authorized to use '0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@amazonses.com' in 'mfrom' identity (mechanism 'ip4:54.240.0.0/18' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@amazonses.com"; helo=a11-124.smtp-out.amazonses.com; client-ip=54.240.11.124 Received: from a11-124.smtp-out.amazonses.com (a11-124.smtp-out.amazonses.com [54.240.11.124]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Thu, 14 Jan 2021 16:34:00 -0500 (EST) (envelope-from 0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@amazonses.com) X-Default-Received-SPF: pass (skip=loggedin (res=PASS)) x-ip-name=166.172.63.41; envelope-from=; From: Mack Wallace Content-Type: multipart/alternative; boundary="Apple-Mail=_780D9F2D-5342-47BB-A1C1-7B046401CF3A" Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.1\)) Message-ID: <0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@email.amazonses.com> Date: Thu, 14 Jan 2021 21:34:00 +0000 To: 9fans@9fans.net X-Mailer: Apple Mail (2.3608.120.23.2.1) X-Authenticated-User: mackbw@mapinternet.com X-SES-Outgoing: 2021.01.14-54.240.11.124 Feedback-ID: 1.us-east-1.X+xhoL9JiEQ8K0gzGjV36WZnSewOzOs8YCWuakKsLBY=:AmazonSES Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 3b2864ee-56b0-11eb-8e4d-b3a2cc35b602 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMDE3ODEzMmYzZDJlZDY4OS1NOTA4YmNhY2UzNjQ3ZGQ5YjkzMDY1?= =?UTF-8?B?YjNmPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Subject: [9fans] Plan9 on Raspberry Pi 400? Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M908bcace3647dd9b93065b3f:1:QHfOXbUM_yEoFq4lGOop365gAzE3YI_yiabgaV61sqs --Apple-Mail=_780D9F2D-5342-47BB-A1C1-7B046401CF3A Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="UTF-8" I recently purchased a Raspberry Pi 400, which is supposed to be a Raspberr= y Pi 4 already inside a keyboard. I thought it would be great to get a plan= 9 terminal on it. However, I am having some trouble; and I don=E2=80=99t k= now if it is specific to the Pi 400, myself, or both. The Pi 400 is the Raspberry Pi keyboard with a =E2=80=98Pi 4=E2=80=99 insid= e. However, the Raspberry Pi 4 is on a different piece of copper. I don=E2= =80=99t know how significant this is or not. Anyway, I downloaded the new 9front image and first used dd to get it onto = a 32GB micro SD card.=20 On first boot, the Plan 9 kernel appears to start loading, and then I got t= he following error repeated over and over sdhc: read error intr 2008002 stat 1fff0000 and then finally /dev/sdM0/data bootargs is (tcp, tls, il, local!device) I=E2=80=99ve tried creating images on the Pi itself in Raspian. Tried booti= ng off of a USB to micro SD adapter - all with similar results, possibly di= fferent or additional errors. I also tried using balenaEtcher to transfer t= he image=E2=80=A6 similar results. One attempted startup looked like this: 127 holes free 0x004f0000 0x3e600000 1041301504 1041301504 bytes free Plan 9 cpu0: 1500 MHz ARM Cortex-A72 r0p3 4006M Memory: 998M kernel data, 3008M user, 15011M swap pcienable PCI.0.0.0: pcr 0->7 pcienable PCI.1.0.0: pcr 0->2 bus dev type vid did intl memory 0 0/0 06 04 00 14e4 2711 0 ioa:00000000-00001000 4096 nema:600000000-6= 00100000 1048576 ->1 1 0/0 0c 03 30 1106 3483 0 0:600000007 4096 #l0: genet: 1000Mbps port 0xFFFFFFFFBD580000 irq 189 ea dca632e63357 usbxhci: 0x1106 0x3483: port 600000000 size 4096 irq 0 cpu3: 1500MHz ARM Cortex-A72 r0p3 cpu2: 1500MHz ARM Cortex-A72 r0p3 cpu1: 1500MHz ARM Cortex-A72 r0p3 #l0: phy1 id 600d84a2 oui 80361 emmc: cmd 371a0000 arg 0 error intr 0 stat 1fff0001 {repeats 15 times} /dev/sdM0: BCM SD Host Controller 02 Version 10 emmc: cmd 371a0000 arg 0 error intr 0 stat 1fff0001 {repeats 10 times} /dev/sdM0/data bootargs is (tcp, tls, il, local!device)[] As mentioned before, where that emmc error is - I=E2=80=99ve seen the previ= ous mentioned error repeated. Or the following two errors. sdhc: read error intr 2008000 stat 1fff0206 emmccmd: need to reset Datainhibit intr 0 stat 1fff0206 I realize this may be because I need a different firmware for the Pi 400. I= see what looks like a file on github for the Pi 400. But I am not sure wha= t to do with it. Is it supposed to be as easy as copying it to the boot par= tition? (I tried that and didn=E2=80=99t work). Do I need to recompile a ke= rnel? Do I need to update the other files in the boot partition with those = for the bootloader firmware for the Pi? Thanks in advance! Mack ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M908bc= ace3647dd9b93065b3f Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --Apple-Mail=_780D9F2D-5342-47BB-A1C1-7B046401CF3A Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset="UTF-8" I recently p= urchased a Raspberry Pi 400, which is supposed to be a Raspberry Pi 4 alrea= dy inside a keyboard. I thought it would be great to get a plan 9 terminal = on it. However, I am having some trouble; and I don’t know if it is s= pecific to the Pi 400, myself, or both.

The Pi 400 is the Raspberry Pi keyboard with a ‘Pi= 4’ inside. However, the Raspberry Pi 4 is on a different piece of co= pper. I don’t know how significant this is or not.

Anyway, I downloaded the new 9fro= nt image and first used dd to get it onto a 32GB micro SD card. 
=

On first boot, the P= lan 9 kernel appears to start loading, and then I got the following error r= epeated over and over

sdhc: read error intr 2008002 stat 1fff0000
and then finally /dev/sdM0/data
bootargs is (tcp, tls, il, local!device)

I’ve tried creating images on= the Pi itself in Raspian. Tried booting off of a USB to micro SD adapter -= all with similar results, possibly different or additional errors. I also = tried using balenaEtcher to transfer the image… similar results.

One attempted star= tup looked like this:

127 holes free
0x004f0000 0x3e600000 1041= 301504
1041301504 = bytes free

Plan 9
= cpu0: 1500 MHz ARM Cortex-A72 r0p3
4006M Memory: 998M kernel data, 3008M user, 15011M swap
pcienable PCI.0.0.0:= pcr 0->7
pcien= able PCI.1.0.0: pcr 0->2
bus dev type     vid  did  intl memory=
0   0/0 06 04 00 14= e4 2711   0  ioa:00000000-00001000 4096 nema:600000000-600100000 = 1048576 ->1
1 &= nbsp; 0/0 0c 03 30 1106 3483   0  0:600000007 4096
#l0: genet: 1000Mbps port 0xFFFF= FFFFBD580000 irq 189 ea dca632e63357
usbxhci: 0x1106 0x3483: port 600000000 size 4096 irq 0
cpu3: 1500MHz ARM C= ortex-A72 r0p3
cpu= 2: 1500MHz ARM Cortex-A72 r0p3
cpu1: 1500MHz ARM Cortex-A72 r0p3
#l0: phy1 id 600d84a2 oui 80361

emmc: cmd 371a= 0000 arg 0 error intr 0 stat 1fff0001
{repeats 15 times}
/dev/sdM0: BCM SD Host Controller 02 Version 10
emmc: cmd 371a0000 arg 0 error int= r 0 stat 1fff0001
= {repeats 1= 0 times}
/dev/sdM0= /data
bootargs is = (tcp, tls, il, local!device)[]


As mentioned befo= re, where that emmc error is - I’ve seen the previous mentioned error= repeated. Or the following two errors.

sdhc: read error intr 2008000 sta= t 1fff0206
emmccmd= : need to reset Datainhibit intr 0 stat 1fff0206

I realize this may be becaus= e I need a different firmware for the Pi 400. I see what looks like a file = on github for the Pi 400. But I am not sure what to do with it. Is it suppo= sed to be as easy as copying it to the boot partition? (I tried that and di= dn’t work). Do I need to recompile a kernel? Do I need to update the = other files in the boot partition with those for the bootloader firmware fo= r the Pi?

Thank= s in advance!

M= ack



= --Apple-Mail=_780D9F2D-5342-47BB-A1C1-7B046401CF3A--