From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.9 required=5.0 tests=DKIM_SIGNED,DKIM_VALID, HTML_MESSAGE,MAILING_LIST_MULTI,RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H4, RCVD_IN_MSPIKE_WL,URIBL_SBL_A autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 16782 invoked from network); 15 Jan 2021 18:44:31 -0000 Received: from tb-ob0.topicbox.com (64.147.108.117) by inbox.vuxu.org with ESMTPUTF8; 15 Jan 2021 18:44:31 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 927862FECC for ; Fri, 15 Jan 2021 13:44:28 -0500 (EST) (envelope-from bounce.mM3e4eaa51003d3faf4b21f271.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 8DD2211F1487; Fri, 15 Jan 2021 13:44:28 -0500 (EST) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=AsR2sD/G header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; spf=pass smtp.mailfrom=01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@amazonses.com smtp.helo=a11-78.smtp-out.amazonses.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:subject:date :references:to:in-reply-to:message-id:list-help:list-id :list-post:list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1610736268; bh=Lzne2Z9OHcoy6ueN TBqE1KgpLiSKr3hpjmmFEYa1fLc=; b=slzFaVWMpUFf6Vz/eM17c5GCDNALu3Ju 1/HWksGk8UQUCQjvaW97qI968Evr2gSDTwh/yHMF0V9su2LuTTEVB67R2hcffTxJ S2uqOv+r3XeK3FMYu4wMG25lite2tl2iT8SuB6qbp/dguZBnYDhiPODLwbQg9Knj CHVWqWTRkwc= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1610736268; b=d5CgxPU6s4qDmcy5o/mhSsoMHq/QiTwkadUicAovPhrchmNBxI B9MKIhqk4T9X0EgFbps2J3v2nmJOSiGer7sSe4+LXDsLovzT0VLKUxGT0kiN0jDx XwsvjXzdbsN5y6Tr0XjotGJKtQBG318ldBY1Nqh5iwuqkSZxgZcIl7pNQ= Authentication-Results: topicbox.com; arc=pass; dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=AsR2sD/G header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; spf=pass smtp.mailfrom=01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@amazonses.com smtp.helo=a11-78.smtp-out.amazonses.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=AsR2sD/G header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.11.78 (a11-78.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@amazonses.com smtp.helo=a11-78.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a11-78.smtp-out.amazonses.com policy.ptr=a11-78.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx3.crocker.rcimx.net,mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h=from :content-type:mime-version:subject:date:references:to :in-reply-to:message-id:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=dkim-1; bh=gV1QoLCR21kzTvjtTvoklyHO/sRi+Ifl QTMf+vU3zIk=; b=P2Eh+XfWWo9nXSlGClHyfEVSMWy7lZI8eCNp5icuxmg0ILlT lrwxSdOGoIUo3hincW8guOQUOY9ykjNoGUh8uawn183USkUOLveABy7DgEI6fXOM AeqU/tRiTBpAvdL+jK4Zl3jDUPwRRnl/HSCucf7ANy7A7Hog9//YqF3XMf0= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 7923E1282897 for <9fans@9fans.net>; Fri, 15 Jan 2021 13:44:18 -0500 (EST) (envelope-from 01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@amazonses.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 9F6DE3C6568; Fri, 15 Jan 2021 13:44:18 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1610736258; b=VaFEulfs26ZqkbGGIMkPXGQLjVjBcThXYmKWKadypcBKxBPTVK VkjSf9bmj138uIePl+8VNQ7+GK016ugnh5l9/tFdlPkWucP1TiDvlLpESqwyCoz7 ToT/4KComXcbz/zolHS+tvBAm87KmnRjlc/FDTXHsA7B91K0/bPLaB5JPc2029hl UCizPpJfGWXQPocAzPflA3Mr/7ywZ9X2Sd8G5i/KY99B+TM00tgSClCu0EB3r//3 /7o/z58Iw8is6/MjRyCepgCFqv1QTPeqmqmw2DhAgo3iStrsE7N9NCz+JKoixdnQ kkAQ8FuMY4L9nBAdKlBghi8C1Xs1aX7CayJg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:subject:date :references:to:in-reply-to:message-id; s=arcseal; t=1610736258; bh=tUqLIPncaQF1L9jWeEaYk8QQNseKg5zsPvSVMKmmv2g=; b=mcNKX2LptMwU HKnJEXaDUQqiWOZ+OxFVgiuFR1G4WyP8jHwPLrk2ZM77a7kxIPTGR/erhDjLKEKS k/5dSFJQSX0buMxaiB/geioI3Rj4BaTEwlezjuBsv2y9ktRB/G7GD91Z48aZ/MNv B0OymNgw62IigE1ViLnF4oRugnRSGS1Ea63egDVzmwEjBAH8x4cz9dk3I+QctHfb Ct7CIxermIYyJEhEkGfQ6I0zYCx406LJM4tXmAtrsKyuXZZvmWkxzaKuBoSQbluf q5RrrcVxx8z0eNphDcRokwPCu1ojnNHVqKjUz0T2Pk8F/L3ER6raj91xOgIopbqk 7Rbv0y22Cg== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=AsR2sD/G header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.11.78 (a11-78.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@amazonses.com smtp.helo=a11-78.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a11-78.smtp-out.amazonses.com policy.ptr=a11-78.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx3.crocker.rcimx.net,mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrtddvgdelvdculddtuddrgeduhedrtddtmd cutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghn shhusghstghrihgsvgdpuffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtne cunecujfgurhephfgtggfuffhfvfgjkffosegrtderrehhtdejnecuhfhrohhmpeforggt khcuhggrlhhlrggtvgcuoehmrggtkhgsfiesmhgrphhinhhtvghrnhgvthdrtghomheqne cuggftrfgrthhtvghrnhepfefhfeduleduledviefghefhteeugedugfehffefjeefveek gfeiieefteeuhfetnecuffhomhgrihhnpehgihhthhhusgdrtghomhdpthhophhitggsoh igrdgtohhmnecukfhppeehgedrvdegtddruddurdejkeenucevlhhushhtvghrufhiiigv pedtnecurfgrrhgrmhepihhnvghtpeehgedrvdegtddruddurdejkedphhgvlhhopegrud duqdejkedrshhmthhpqdhouhhtrdgrmhgriihonhhsvghsrdgtohhmpdhmrghilhhfrhho mhepoedtuddttddtudejjedtjeehtggtledtjedqsgejkeejledutdgrqdgstgegiedqge duvghfqdgsrggtfedqvdefudegsggtfeejfeejgegrqddttddttddttdesrghmrgiiohhn shgvshdrtghomheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (amazonses.com: 54.240.11.78 is authorized to use '01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@amazonses.com' in 'mfrom' identity (mechanism 'ip4:54.240.0.0/18' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@amazonses.com"; helo=a11-78.smtp-out.amazonses.com; client-ip=54.240.11.78 Received: from a11-78.smtp-out.amazonses.com (a11-78.smtp-out.amazonses.com [54.240.11.78]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 15 Jan 2021 13:44:18 -0500 (EST) (envelope-from 01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@amazonses.com) X-Default-Received-SPF: pass (skip=loggedin (res=PASS)) x-ip-name=50.202.122.66; envelope-from=; From: Mack Wallace Content-Type: multipart/alternative; boundary="Apple-Mail=_E4FD8507-1AC3-471B-92E8-0427740F9798" Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.1\)) Subject: Re: [9fans] Plan9 on Raspberry Pi 400? Date: Fri, 15 Jan 2021 18:44:17 +0000 References: <0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@email.amazonses.com> <0100017703434c67-b7a3d36a-2d2d-42ff-85f8-ac39d964354f-000000@email.amazonses.com> To: 9fans <9fans@9fans.net> In-Reply-To: Message-ID: <01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@email.amazonses.com> X-Mailer: Apple Mail (2.3608.120.23.2.1) X-Authenticated-User: mackbw@mapinternet.com X-SES-Outgoing: 2021.01.15-54.240.11.78 Feedback-ID: 1.us-east-1.X+xhoL9JiEQ8K0gzGjV36WZnSewOzOs8YCWuakKsLBY=:AmazonSES Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: b00f1814-5761-11eb-a974-ff1a61e1ae42 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMDE3ODEzMmYzZDJlZDY4OS1NM2U0ZWFhNTEwMDNkM2ZhZjRiMjFm?= =?UTF-8?B?MjcxPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M3e4eaa51003d3faf4b21f271:1:T0gJEvHutfxs521Nx7sDLuMJwonsnLqSDMZtp8kB0Ww --Apple-Mail=_E4FD8507-1AC3-471B-92E8-0427740F9798 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="UTF-8" Dear Skip, That pushed the ball forward significantly, but I still have issues. (But t= hank you, every little advancement helps.) So with that flag, I was able to= get Richard=E2=80=99s port to boot into Glenda=E2=80=99s account (showing = acme, faces, stats, etc). However, I do not seem to have any USB; no mouse;= nor keyboard. Stats is moving on the screen, so things are not too locked = up. I did try rebooting with an external keyboard and another mouse. Still = nothing. The external keyboard doesn=E2=80=99t respond to anything (no caps= lock nor num lock.) One mouse is in the USB 2.0 port, another and the exte= rnal keyboard are in the USB 3.0 ports.=20 on boot, I see the following: usbxhci: 0x1106 0x3483 port 600000000 size 0x1000 irq0 #u/usb/ep1.0: xhci port 0x0 irq 0 The line before is #l for the network, The line after is the detection of the other three cores. The changing of the enable_gic=3D1 on the 9front image seemed to have to ef= fect. Thanks again! Mack On Jan 14, 2021, at 8:15 PM, Skip Tavakkolian = wrote: >=20 > I'm using a RPi400 with Richard's port. I'm netbooting without issues and= up for days. The only issue I had was forgetting to set 'enable_gic=3D1' = as Richard instructed in the sources. Pi4 works ok without it, pi400 doesn'= t. >=20 >=20 > On Thu, Jan 14, 2021, 3:39 PM Mack Wallace > wrote: > Thank you for the reply Stuart, but no luck. >=20 > I did download Mr. Miller=E2=80=99s image. It would not boot at all until= I replaced the files that you mention, but the kernel in that image locks = up after detecting the fourth core of the CPU. However, from that failure I= learned that those files, (start_cd.elf, start4cd.elf, fixup_cd.dat, fixup= 4cd.dat) are necessary for the Pi to boot, and that those with the bootcode= .bin and presumably, but it doesn=E2=80=99t seem to matter whether I use bc= m2711-rpi-4-b.dtb or bcm2711-rpi-400.dtb - the dtbs are vital to the proces= s. - and that all those files simply need to be copied into the fat partiti= on/boot directory. >=20 > So I burned another image (actually many, trying different SD cards, and = different configurations, older kernels, etc) and replaced all the files I= =E2=80=99ve mentioned with the ones from https://github.com/raspberrypi/fir= mware/tree/master/boot (hopefully that=E2=80=99s where I should get them). My most recent i= teration just has the single error repeated: >=20 > sdhc: read error intr 2008002 stat 1fff0000 >=20 > This occurs many times. In the middle of these errors is=20 >=20 > /dev/sdM0: BCM SD Host Controller 02 Version 10 >=20 > then the error repeats itself over 50 times before printing out the lines > /dev/sdM0/data > bootargs is (tcp, tls, il, local!device)[] >=20 > At no time during this process is the keyboard or mouse responsive. Thoug= h the mouse icon did become visible during the boot process.=20 >=20 > I am hoping I am wrong, but I am thinking there is some sort of driver is= sue. At the very least, checking what media there is to mount, or reading t= he SD card. And then possibly for other things, but the former could be gum= ming up the works for everything else. >=20 >=20 >> On Jan 14, 2021, at 6:05 PM, Stuart Morrow > wrote: >>=20 >> Try copying the .dtb *and* the start4 and fixup4. >>=20 >> ------------------------------------------ >> 9fans: 9fans >> Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M9f= 2c8a9a58f03931b399b823 >> Delivery options: https://9fans.topicbox.com/groups/9fans/subscription <= https://9fans.topicbox.com/groups/9fans/subscription> >>=20 >=20 > 9fans / 9fans / see discussions + participants + delivery options Permalink ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M3e4ea= a51003d3faf4b21f271 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --Apple-Mail=_E4FD8507-1AC3-471B-92E8-0427740F9798 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset="UTF-8" Dear Skip,
That pushed the ball f= orward significantly, but I still have issues. (But thank you, every little= advancement helps.) So with that flag, I was able to get Richard’s p= ort to boot into Glenda’s account (showing acme, faces, stats, etc). = However, I do not seem to have any USB; no mouse; nor keyboard. Stats is mo= ving on the screen, so things are not too locked up. I did try rebooting wi= th an external keyboard and another mouse. Still nothing. The external keyb= oard doesn’t respond to anything (no caps lock nor num lock.) One mou= se is in the USB 2.0 port, another and the external keyboard are in the USB= 3.0 ports. 

on boot, I see the following:
usbxhci: 0x1106 0x348= 3 port 600000000 size 0x1000 irq0
#u/usb/ep1.0: xhci p= ort 0x0 irq 0

T= he line before is #l for the network,
The line after i= s the detection of the other three cores.

The changing of the enable_gic=3D1 on the 9front= image seemed to have to effect.

Thanks again!

Mack


On Jan 14, 2021, at 8:15 PM, = Skip Tavakkolian <skip.tavakkolian@gmail.com> wrote:

=
I'm using = a RPi400 with Richard's port. I'm netbooting without issues and up = for days.  The only issue I had was forgetting to set 'enable_gic= =3D1' as Richard instructed in the sources. Pi4 works ok without it, pi= 400 doesn't.


On Thu, Jan 14, 20= 21, 3:39 PM Mack Wallace <mackbw@mapinternet.c= om> wrote:
Tha= nk you for the reply Stuart, but no luck.

<= /div>
I did download Mr. Miller’s image. It would not = boot at all until I replaced the files that you mention, but the kernel in = that image locks up after detecting the fourth core of the CPU. However, fr= om that failure I learned that those files, (start_cd.elf, start4cd.elf, fi= xup_cd.dat, fixup4cd.dat) are necessary for the Pi to boot, and that those = with the bootcode.bin and presumably, but it doesn’t seem to matter w= hether I use bcm2711-rpi-4-b.dtb or bcm2711-rpi-400.dtb - the dtbs are vita= l to the process. - and that all those files simply need to be copied into = the fat partition/boot directory.

So I burned another image (actually many, trying differe= nt SD cards, and different configurations, older kernels, etc) and replaced= all the files I’ve mentioned with the ones from https://github.com/raspber= rypi/firmware/tree/master/boot (hopefully that’s where I sho= uld get them). My most recent iteration just has the single error repeated:=

sdhc: read err= or intr 2008002 stat 1fff0000

<= div class=3D"">This occurs many times. In the middle of these errors is&nbs= p;

/dev/sdM0: B= CM SD Host Controller 02 Version 10

<= /div>
then the error repeats itself over 50 times before pri= nting out the lines
/dev/sdM0/data
bootargs is (tcp, tls, il, local!device)[]

At no time during this process is the keyboar= d or mouse responsive. Though the mouse icon did become visible during the = boot process. 

I am hoping I am wrong, but I am thinking there is some sort of drive= r issue. At the very least, checking what media there is to mount, or readi= ng the SD card. And then possibly for other things, but the former could be= gumming up the works for everything else.


On Jan 14, 2021, at 6:05 PM, Stuar= t Morrow <morrow.stuart@gmail.com<= /a>> wrote:

Try co= pying the .dtb *and* the start4 and fixup4.

------------------------------------------
9fans: 9fansPermalink: https://9fans.topicbox.com/groups= /9fans/T0178132f3d2ed689-M9f2c8a9a58f03931b399b823
Deli= very options: h= ttps://9fans.topicbox.com/groups/9fans/subscription

<= /blockquote>

= --Apple-Mail=_E4FD8507-1AC3-471B-92E8-0427740F9798--