From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.9 required=5.0 tests=DKIM_SIGNED,DKIM_VALID, HTML_MESSAGE,MAILING_LIST_MULTI,RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H4, RCVD_IN_MSPIKE_WL,URIBL_SBL_A autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 24831 invoked from network); 15 Jan 2021 19:54:42 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 15 Jan 2021 19:54:42 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 7649F25BB4 for ; Fri, 15 Jan 2021 14:54:40 -0500 (EST) (envelope-from bounce.mM7fc239ed3107974a45f2ee07.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 70D7E11F992F; Fri, 15 Jan 2021 14:54:40 -0500 (EST) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=FNh/jVNY header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; spf=pass smtp.mailfrom=01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@amazonses.com smtp.helo=a11-127.smtp-out.amazonses.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:subject:date :references:to:in-reply-to:message-id:list-help:list-id :list-post:list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1610740480; bh=9yeJQ4850c1yiW96 7rN4HoKKAjClrmZJl67cKEDP7v8=; b=QPyYnVuYSIuiWPlF25MTMStsoj4ahaCz 6wPKG/5veMqqKeNZs95oVA31FQdiMf+q+bAysvIhk+9DZKAXmLSM2aY1cmcs2eRE RUB8m3kXSL3ECmVWXWYw3D+CioJqYCf/EfjnUE1VFMKS7Ahjhda0d0edKw8yBN22 qRnJuEhrDLM= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1610740480; b=Xx5E7ohJmT4aUctyJwwp0kkG1DwkciUw2rvPZCvHd//wYbc6eQ /jNCHIzUIrAPrDlWyof1MszhVz7lEIEcsLper/VOPJW84zR2GpF82oOoy23zDu41 WHNRfzEA9zmLdGVpvjF67zNYB3QQaggcxBz5SQ3xYzrptz9iLHWMDoRDo= Authentication-Results: topicbox.com; arc=pass; dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=FNh/jVNY header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; spf=pass smtp.mailfrom=01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@amazonses.com smtp.helo=a11-127.smtp-out.amazonses.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=FNh/jVNY header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.11.127 (a11-127.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@amazonses.com smtp.helo=a11-127.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a11-127.smtp-out.amazonses.com policy.ptr=a11-127.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx3.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net,mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h=from :content-type:mime-version:subject:date:references:to :in-reply-to:message-id:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=dkim-1; bh=lMX9ehqcu5++cmc1qbYQxeKRtPxKeVlb EuijHM2p1Q8=; b=ArmR2spq6BxPkQ3cWDpP5VZGltZ1+5oCA1y4GMWlzOJKm9Cd jHwYzRhoTLZit2yQjacy9plNGW8BgnQ+L3aiI/NLkSfAe8It6NHJCt5yjd6LQiLr B77ccdG/F262ggE9yh0E5aMSX+8Z2K7ZfzehDD1Vf5rVGwcRWFxaSn9oUko= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 7D73411F954E for <9fans@9fans.net>; Fri, 15 Jan 2021 14:54:29 -0500 (EST) (envelope-from 01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@amazonses.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 306696CE223; Fri, 15 Jan 2021 14:54:29 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1610740469; b=xIQh+PXkZiu8bnUcFj+2OJAGTReaMZu0lBVFjzdpDWGps6kyH2 ByOBLx0FQ2BMsQpbhpXZ5XO4qS3xBrArhodCKxDJBh1faltJDbRftc8X8HGxN4KJ vP70PNn44aLKXqKwN085BpsMyDpsHfJCeCqrGaBnTKdUf37gAfY/ybqn3odtX8BC fk+whhrLEVxf11bpAsPWf1HBlBCRxY1Ws1GJtW9W9MuW2LPyPSFqNjld/udFgO+g rcEvTv21wbRmtRjqHKlPC68marQHQFIwy+2H8zX0ar5u9yoHUb/8W4SAVXnT0445 6dVnuhNVP7mRJEWnlcbsFRLjwE+81E/DGgMw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:subject:date :references:to:in-reply-to:message-id; s=arcseal; t=1610740469; bh=b/M39tMvNHlsqdISwxIj0W0WWqSrZBT2mIM6iN1Qo10=; b=N7K/uo6XMKKk NHR0dI7nGAfdAw95PTthyITQBgCnBzJ37iorp5ZAAcvVmeg51/DzCW7aL8KT9ib8 S+QRa6YETzEYhCmFR/LguLGMm3rM33mImAGeJdWKZQhle340c7iM0/rnNM6R5XvK 0uKfT9E6wbGRAfkbvhiLVer4Ztw70BUodHQyT4p4zWo7Ndr99RT40ilvKm7Avm5z b9HhyqcLGKHnWMQibaAeefduegnPugjJDcryc54SA7sy/diMF94LeInLgbWdb/PA rrCZmk4tg0dOyUARJ3Oy8yM1sqaQqlhxI0BKtXt3jWSdSS6Pp3us9Ig+zgntzFIy l0a7ST7DwA== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=FNh/jVNY header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.11.127 (a11-127.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@amazonses.com smtp.helo=a11-127.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a11-127.smtp-out.amazonses.com policy.ptr=a11-127.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx3.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net,mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrtddvgddutdejucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhtggguf fffhfvjgfkofesrgdtreerhhdtjeenucfhrhhomhepofgrtghkucghrghllhgrtggvuceo mhgrtghksgifsehmrghpihhnthgvrhhnvghtrdgtohhmqeenucggtffrrghtthgvrhhnpe efhfefudeludelvdeigfehhfetueegudfghefffeejfeevkefgieeifeetuefhteenucff ohhmrghinhepghhithhhuhgsrdgtohhmpdhtohhpihgtsghogidrtghomhenucfkphephe egrddvgedtrdduuddruddvjeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhep ihhnvghtpeehgedrvdegtddruddurdduvdejpdhhvghloheprgduuddquddvjedrshhmth hpqdhouhhtrdgrmhgriihonhhsvghsrdgtohhmpdhmrghilhhfrhhomhepoedtuddttddt udejjedtjeelugdtrgdvrgdqleejhegvudgstghfqddutggriedqgedttgehqdelvddule dqtdeltdguugdtugeifhgrrggsqddttddttddttdesrghmrgiiohhnshgvshdrtghomheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (amazonses.com: 54.240.11.127 is authorized to use '01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@amazonses.com' in 'mfrom' identity (mechanism 'ip4:54.240.0.0/18' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@amazonses.com"; helo=a11-127.smtp-out.amazonses.com; client-ip=54.240.11.127 Received: from a11-127.smtp-out.amazonses.com (a11-127.smtp-out.amazonses.com [54.240.11.127]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 15 Jan 2021 14:54:28 -0500 (EST) (envelope-from 01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@amazonses.com) X-Default-Received-SPF: pass (skip=loggedin (res=PASS)) x-ip-name=50.202.122.66; envelope-from=; From: Mack Wallace Content-Type: multipart/alternative; boundary="Apple-Mail=_46836032-FEFA-4099-B288-57509F4F461D" Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.1\)) Subject: Re: [9fans] Plan9 on Raspberry Pi 400? Date: Fri, 15 Jan 2021 19:54:28 +0000 References: <0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@email.amazonses.com> <0100017703434c67-b7a3d36a-2d2d-42ff-85f8-ac39d964354f-000000@email.amazonses.com> <01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@email.amazonses.com> To: 9fans <9fans@9fans.net> In-Reply-To: <01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@email.amazonses.com> Message-ID: <01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@email.amazonses.com> X-Mailer: Apple Mail (2.3608.120.23.2.1) X-Authenticated-User: mackbw@mapinternet.com X-SES-Outgoing: 2021.01.15-54.240.11.127 Feedback-ID: 1.us-east-1.X+xhoL9JiEQ8K0gzGjV36WZnSewOzOs8YCWuakKsLBY=:AmazonSES Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 7e6b6a88-576b-11eb-a6fc-8ee6af3e52be Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMDE3ODEzMmYzZDJlZDY4OS1NN2ZjMjM5ZWQzMTA3OTc0YTQ1ZjJl?= =?UTF-8?B?ZTA3Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M7fc239ed3107974a45f2ee07:1:xCusfdtC3lS8v7-qobDdTE8pBiWU0psRnj84sqHWqi4 --Apple-Mail=_46836032-FEFA-4099-B288-57509F4F461D Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="UTF-8" I took that microSD card that has the bootable image without USB and put it= into a traditional Pi4. It boots on that without a problem and has mouse a= nd keyboard. I notices that after the additional CPU cores are detected, th= at is mentions usb/hub=E2=80=A6 usb/kbd=E2=80=A6. The image when booting o= n the Pi 400 never provides those messages. Regards, Mack=20 > On Jan 15, 2021, at 1:44 PM, Mack Wallace wrote: >=20 > Dear Skip, >=20 > That pushed the ball forward significantly, but I still have issues. (But= thank you, every little advancement helps.) So with that flag, I was able = to get Richard=E2=80=99s port to boot into Glenda=E2=80=99s account (showin= g acme, faces, stats, etc). However, I do not seem to have any USB; no mous= e; nor keyboard. Stats is moving on the screen, so things are not too locke= d up. I did try rebooting with an external keyboard and another mouse. Stil= l nothing. The external keyboard doesn=E2=80=99t respond to anything (no ca= ps lock nor num lock.) One mouse is in the USB 2.0 port, another and the ex= ternal keyboard are in the USB 3.0 ports.=20 >=20 > on boot, I see the following: > usbxhci: 0x1106 0x3483 port 600000000 size 0x1000 irq0 > #u/usb/ep1.0: xhci port 0x0 irq 0 >=20 > The line before is #l for the network, > The line after is the detection of the other three cores. >=20 > The changing of the enable_gic=3D1 on the 9front image seemed to have to = effect. >=20 > Thanks again! >=20 > Mack >=20 >=20 > On Jan 14, 2021, at 8:15 PM, Skip Tavakkolian > wrote: >>=20 >> I'm using a RPi400 with Richard's port. I'm netbooting without issues an= d up for days. The only issue I had was forgetting to set 'enable_gic=3D1'= as Richard instructed in the sources. Pi4 works ok without it, pi400 doesn= 't. >>=20 >>=20 >> On Thu, Jan 14, 2021, 3:39 PM Mack Wallace > wrote: >> Thank you for the reply Stuart, but no luck. >>=20 >> I did download Mr. Miller=E2=80=99s image. It would not boot at all unti= l I replaced the files that you mention, but the kernel in that image locks= up after detecting the fourth core of the CPU. However, from that failure = I learned that those files, (start_cd.elf, start4cd.elf, fixup_cd.dat, fixu= p4cd.dat) are necessary for the Pi to boot, and that those with the bootcod= e.bin and presumably, but it doesn=E2=80=99t seem to matter whether I use b= cm2711-rpi-4-b.dtb or bcm2711-rpi-400.dtb - the dtbs are vital to the proce= ss. - and that all those files simply need to be copied into the fat partit= ion/boot directory. >>=20 >> So I burned another image (actually many, trying different SD cards, and= different configurations, older kernels, etc) and replaced all the files I= =E2=80=99ve mentioned with the ones from https://github.com/raspberrypi/fir= mware/tree/master/boot (hopefully that=E2=80=99s where I should get them). My most recent i= teration just has the single error repeated: >>=20 >> sdhc: read error intr 2008002 stat 1fff0000 >>=20 >> This occurs many times. In the middle of these errors is=20 >>=20 >> /dev/sdM0: BCM SD Host Controller 02 Version 10 >>=20 >> then the error repeats itself over 50 times before printing out the lines >> /dev/sdM0/data >> bootargs is (tcp, tls, il, local!device)[] >>=20 >> At no time during this process is the keyboard or mouse responsive. Thou= gh the mouse icon did become visible during the boot process.=20 >>=20 >> I am hoping I am wrong, but I am thinking there is some sort of driver i= ssue. At the very least, checking what media there is to mount, or reading = the SD card. And then possibly for other things, but the former could be gu= mming up the works for everything else. >>=20 >>=20 >>> On Jan 14, 2021, at 6:05 PM, Stuart Morrow > wrote: >>>=20 >>> Try copying the .dtb *and* the start4 and fixup4. >>>=20 >>> ------------------------------------------ >>> 9fans: 9fans >>> Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M9= f2c8a9a58f03931b399b823 >>> Delivery options: https://9fans.topicbox.com/groups/9fans/subscription = >>>=20 >=20 > 9fans / 9fans / see discussions + participants + delivery options Permalink ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M7fc23= 9ed3107974a45f2ee07 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --Apple-Mail=_46836032-FEFA-4099-B288-57509F4F461D Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset="UTF-8" I took that = microSD card that has the bootable image without USB and put it into a trad= itional Pi4. It boots on that without a problem and has mouse and keyboard.= I notices that after the additional CPU cores are detected, that is mentio= ns usb/hub… usb/kbd….  The image when booting on the Pi = 400 never provides those messages.

Regards,

Mack 

On Jan 15, 2021, at 1:44 PM, Mack Walla= ce <mackbw@mapinter= net.com> wrote:

Dear Skip,

That pushed the ball forward s= ignificantly, but I still have issues. (But thank you, every little advance= ment helps.) So with that flag, I was able to get Richard’s port to b= oot into Glenda’s account (showing acme, faces, stats, etc). However,= I do not seem to have any USB; no mouse; nor keyboard. Stats is moving on = the screen, so things are not too locked up. I did try rebooting with an ex= ternal keyboard and another mouse. Still nothing. The external keyboard doe= sn’t respond to anything (no caps lock nor num lock.) One mouse is in= the USB 2.0 port, another and the external keyboard are in the USB 3.0 por= ts. 

on bo= ot, I see the following:
usbxhci: 0x1106 0x3483 port 6= 00000000 size 0x1000 irq0
#u/usb/ep1.0: xhci port 0x0 = irq 0

The line = before is #l for the network,
The line after is the de= tection of the other three cores.

The changing of the enable_gic=3D1 on the 9front image s= eemed to have to effect.

Thanks again!

Mack

<= br class=3D"" />
On Jan 14, 2021, at 8:15 PM, Skip Tav= akkolian <skip.= tavakkolian@gmail.com> wrote:
<= blockquote class=3D"" type=3D"cite">
I'm usi= ng a RPi400 with Richard's port. I'm netbooting without issues and = up for days.  The only issue I had was forgetting to set 'enable_g= ic=3D1' as Richard instructed in the sources. Pi4 works ok without it, = pi400 doesn't.


On Thu, Jan 14, = 2021, 3:39 PM Mack Wallace <mackbw@mapinternet= .com> wrote:
T= hank you for the reply Stuart, but no luck.

I did download Mr. Miller’s image. It would no= t boot at all until I replaced the files that you mention, but the kernel i= n that image locks up after detecting the fourth core of the CPU. However, = from that failure I learned that those files, (start_cd.elf, start4cd.elf, = fixup_cd.dat, fixup4cd.dat) are necessary for the Pi to boot, and that thos= e with the bootcode.bin and presumably, but it doesn’t seem to matter= whether I use bcm2711-rpi-4-b.dtb or bcm2711-rpi-400.dtb - the dtbs are vi= tal to the process. - and that all those files simply need to be copied int= o the fat partition/boot directory.

<= /div>
So I burned another image (actually many, trying diffe= rent SD cards, and different configurations, older kernels, etc) and replac= ed all the files I’ve mentioned with the ones from https://github.com/raspb= errypi/firmware/tree/master/boot (hopefully that’s where I s= hould get them). My most recent iteration just has the single error repeate= d:

sdhc: read e= rror intr 2008002 stat 1fff0000

This occurs many times. In the middle of these errors is&n= bsp;

/dev/sdM0:= BCM SD Host Controller 02 Version 10

then the error repeats itself over 50 times before p= rinting out the lines
/dev/sdM0/data
bootargs is (tcp, tls, il, local!device)[]

At no time during this process is the key= board or mouse responsive. Though the mouse icon did become visible during = the boot process. 

I am hoping I am wrong, but I am thinking there is some sort of dr= iver issue. At the very least, checking what media there is to mount, or re= ading the SD card. And then possibly for other things, but the former could= be gumming up the works for everything else.


On Jan 14, 2021, at 6:05 PM, Stua= rt Morrow <morrow.stuart@gmail.com= > wrote:

Try c= opying the .dtb *and* the start4 and fixup4.

------------------------------------------
9fans: 9fans<= br class=3D"" />Permalink: https://9fans.topicbox.com/group= s/9fans/T0178132f3d2ed689-M9f2c8a9a58f03931b399b823
Del= ivery options: = https://9fans.topicbox.com/groups/9fans/subscription

=


= --Apple-Mail=_46836032-FEFA-4099-B288-57509F4F461D--