From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.9 required=5.0 tests=DKIM_SIGNED,DKIM_VALID, MAILING_LIST_MULTI,RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H4, RCVD_IN_MSPIKE_WL,URIBL_SBL_A autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 26434 invoked from network); 16 Jan 2021 00:31:33 -0000 Received: from tb-ob0.topicbox.com (64.147.108.117) by inbox.vuxu.org with ESMTPUTF8; 16 Jan 2021 00:31:33 -0000 Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 68F233573A for ; Fri, 15 Jan 2021 19:31:30 -0500 (EST) (envelope-from bounce.mM3622aa098d3909dba1f462c6.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 63EF7126826B; Fri, 15 Jan 2021 19:31:30 -0500 (EST) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=hEVX9rPe header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; spf=pass smtp.mailfrom=01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@amazonses.com smtp.helo=a48-181.smtp-out.amazonses.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:content-transfer-encoding :mime-version:subject:date:references:to:in-reply-to:message-id :list-help:list-id:list-post:list-subscribe:reply-to :list-unsubscribe; s=sysmsg-1; t=1610757090; bh=f4p1xeAqlgR0ztKM TF2v6Iw2w/2gHQ0qQeW590y02d4=; b=bin07X91aWLY5WvAuS4g1WkkGmxLWsxR tjNkthhzCpR9wO5cSEWZsMzvAruTYCcxFrELovgUxQ2ItD0rNCrFzkY8a3t4fg0r H7uiYhnyfrT6cGg9m52x5vgTqKM9F5lajqv9I3mGyfl+m8J76BGcmijAJq3W2auH ScQ1gFJ4Gzg= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1610757090; b=BsWynUpgN/+JYhj3s1KtaFHwSq4GZ6P6klX1kht/WR0ecwK3FP nh0YXg15pfF4yKQJFHbX/X700rLV23uXvyZnMNWjkuuYPxQ5Qtx8EILWx2bCJTgN p4V3f+c4hHZ7Lxo+XJdGU2CpoCVc7mDhfmXKbxLm+5QvQAWJDa1d0J49U= Authentication-Results: topicbox.com; arc=pass; dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=hEVX9rPe header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; spf=pass smtp.mailfrom=01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@amazonses.com smtp.helo=a48-181.smtp-out.amazonses.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=hEVX9rPe header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.48.181 (a48-181.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@amazonses.com smtp.helo=a48-181.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a48-181.smtp-out.amazonses.com policy.ptr=a48-181.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx3.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h=from :content-type:content-transfer-encoding:mime-version:subject :date:references:to:in-reply-to:message-id:list-help:list-id :list-post:list-subscribe:reply-to:list-unsubscribe; s=dkim-1; bh=kNm2cuC6yc3cbxsbf3C8f29RcDlUQpn2/0fNjkbC57g=; b=Chgai2jcLVG1 F5gwJH3v4que/NKOW+BAPorn2pjhs44s2b8EBug/7pwc68sbfK1SBOFyg6MjtbxI 0MBasfrMSFPQ5OuVPxFpaSrHiFqIE5MwcEb619MtdzTTJxHcZGjoS1igd2Tc5tD9 CmHRRpBvXa7zrSMBDnyHRhDzGnn0vqY= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 51D23128FEC2 for <9fans@9fans.net>; Fri, 15 Jan 2021 19:31:21 -0500 (EST) (envelope-from 01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@amazonses.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id CEBE8156284; Fri, 15 Jan 2021 19:31:21 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1610757081; b=ug1kHhxdt/2v6A3jbyUp9BcworPwx6jRD9xe2IYi8btm+e8UZw s6eZOgklRzUAGw/ovjK6MQVppMUbMLVzn2D5HvDwU8JMkEMVyEmgrtS3Up0FXrNA cSknhZC7E6INrYysY6PAs4R8oSxZDtuNkOSzwX6LvORKaQEb5pxhcT2VC+rqu7Uk 8ZAODTPvjxddgnhDSWshtmq8ma/IYqeySCrNnYdnyNLQCBI9nOLCsyo/EcPV7MK9 +1Li/Q1wR/hdMJ9rcieIFuFNPTiLayKtEDMQj30JZqRcsh2eayeO6M3dECyx6lIb wDev61Q+ipSOxbEykCwuMFDhLHTBF0pbIQlg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:content-transfer-encoding :mime-version:subject:date:references:to:in-reply-to:message-id; s=arcseal; t=1610757081; bh=5Gd9f2gaURIq68xeuRESqVI98eEp1Yw2xBE g4oEk2H8=; b=Hn8KErQO055QoPLIZfrND/w1Wsa3MaInbu0bDcNhO9i6kXZEx5I DnI3RhK57U4UvmzZDQCdkjNqb9tWYDIBMYrjhaiL9jYqmRyy3UEBNQ5oAuqG1fQT nyLGWILky9gwuyGL3hMF8MMUxTyza1Gg53im8J7z3aI2bzIK5S3KKT3ECz1qNno6 TdAb61pgnCqBaePuXkQUDRnrZt45KmYuER4MRvu8LeQSo4/CK6Ka9zCIUQCIYfze vLB+Yg3gxZamXKE+3EiC2XXjbD/s+Uf9OSAhwu+TTKcsPheNVhZ3fEBk8mlhN0Bv N9AmhSqxhTf0/aY10CgBgOCKhms/BpJsAXw== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (1024-bit rsa key sha256) header.d=amazonses.com header.i=@amazonses.com header.b=hEVX9rPe header.a=rsa-sha256 header.s=224i4yxa5dv7c2xz3womw6peuasteono x-bits=1024; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=mapinternet.com; iprev=pass smtp.remote-ip=54.240.48.181 (a48-181.smtp-out.amazonses.com); spf=pass smtp.mailfrom= 01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@amazonses.com smtp.helo=a48-181.smtp-out.amazonses.com; x-aligned-from=fail; x-ptr=pass smtp.helo=a48-181.smtp-out.amazonses.com policy.ptr=a48-181.smtp-out.amazonses.com; x-return-mx=pass header.domain=mapinternet.com policy.is_org=yes (MX Records found: mapinternet.com.mx4.crocker.rcimx.net,mapinternet.com.mx3.crocker.rcimx.net,mapinternet.com.mx1.crocker.rcimx.net,mapinternet.com.mx2.crocker.rcimx.net); x-return-mx=pass smtp.domain=amazonses.com policy.is_org=yes (MX Records found: feedback-smtp.us-east-1.amazonses.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrtdefgddvfecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdpuffr tefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhephfgtgfgguf fffhfvjgfkofesthhqredthhdtjeenucfhrhhomhepofgrtghkucghrghllhgrtggvuceo mhgrtghksgifsehmrghpihhnthgvrhhnvghtrdgtohhmqeenucggtffrrghtthgvrhhnpe ejiedujefhfeehtddvtdeltddvieffkeefhedtudekvdevieefkedvlefhheeigeenucff ohhmrghinheplehprdhiohdpghhithhhuhgsrdgtohhmpdhtohhpihgtsghogidrtghomh enucfkphepheegrddvgedtrdegkedrudekudenucevlhhushhtvghrufhiiigvpedtnecu rfgrrhgrmhepihhnvghtpeehgedrvdegtddrgeekrddukedupdhhvghloheprgegkedqud ekuddrshhmthhpqdhouhhtrdgrmhgriihonhhsvghsrdgtohhmpdhmrghilhhfrhhomhep oedtuddttddtudejjedtkeelrgekgeejhedqiegrsgdvvdeluggsqddtieeitddqgehfhe dvqdgrvdhfugdqvddugegsvggsiegrkeegfedvqddttddttddttdesrghmrgiiohhnshgv shdrtghomheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (amazonses.com: 54.240.48.181 is authorized to use '01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@amazonses.com' in 'mfrom' identity (mechanism 'ip4:54.240.0.0/18' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@amazonses.com"; helo=a48-181.smtp-out.amazonses.com; client-ip=54.240.48.181 Received: from a48-181.smtp-out.amazonses.com (a48-181.smtp-out.amazonses.com [54.240.48.181]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 15 Jan 2021 19:31:20 -0500 (EST) (envelope-from 01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@amazonses.com) X-Default-Received-SPF: pass (skip=loggedin (res=PASS)) x-ip-name=98.216.163.228; envelope-from=; From: Mack Wallace Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Mime-Version: 1.0 (Mac OS X Mail 13.4 \(3608.120.23.2.1\)) Subject: Re: [9fans] Plan9 on Raspberry Pi 400? Date: Sat, 16 Jan 2021 00:31:20 +0000 References: <0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@email.amazonses.com> <0100017703434c67-b7a3d36a-2d2d-42ff-85f8-ac39d964354f-000000@email.amazonses.com> <01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@email.amazonses.com> <01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@email.amazonses.com> To: 9fans <9fans@9fans.net> In-Reply-To: Message-ID: <01000177089a8475-6ab229db-0660-4f52-a2fd-214beb6a8432-000000@email.amazonses.com> X-Mailer: Apple Mail (2.3608.120.23.2.1) X-Authenticated-User: mackbw@mapinternet.com X-SES-Outgoing: 2021.01.16-54.240.48.181 Feedback-ID: 1.us-east-1.X+xhoL9JiEQ8K0gzGjV36WZnSewOzOs8YCWuakKsLBY=:AmazonSES Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 2ac6ede0-5792-11eb-a2bd-cee210f52d6b Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMDE3ODEzMmYzZDJlZDY4OS1NMzYyMmFhMDk4ZDM5MDlkYmExZjQ2?= =?UTF-8?B?MmM2Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M3622aa098d3909dba1f462c6:1:_27_ff412Ww7UYdLs-yYrLkbo_Sxve_e1u85N_2e4fE I did try to boot into Linux and then d a soft reset into Plan9. Still the = same thing, no USB. I tried booting from the on-board card slot, and then a= s I soft rebooted, swapped out the card. As well as booted Raspian off of a= microSD adapter and after booting, put the plan 9 card in the on-board slo= t. No luck. As those that have been looking (Thank you btw). I started searching when M= ichael mentioned that the xhci firmware is not resident on the Pi 400. Of c= ourse there was talk about the Compute module, and then about memory offset= s depending on how much memory is on the Pi=E2=80=A6 a bit over my head at = this point. I did notice, that Richards image that I have, seems to only recognize 1GB = of ram. I am not terribly worried about that unless it=E2=80=99s a symptom = of something else. Thanks, Mack > On Jan 15, 2021, at 5:52 PM, Michael Engel wrote: >=20 > I assume loading the firmware via Linux first won't help since a PCIe res= et probably also=20 > resets the USB controller. >=20 > However, I just checked Richard's kernel source and it seems the firmware= loading functionality > is already included, there is a call to >=20 > xhcireset(BUSBNO(hp->tbdf)<<20 | BUSDNO(hp->tbdf)<<15 | BUSFNO(hp-= >tbdf)<<12); >=20 > in http://9p.io/sources/contrib/miller/9/bcm/usbxhci.c >=20 > The comment for xhcireset in http://9p.io/sources/contrib/miller/9/bcm/vc= ore.c confirms this: > /* > * Notify gpu that xhci firmware might need loading. This is for some > * pi4 board versions which are missing the eeprom chip for the vl805, > * requiring its firmware to come from the boot eeprom instead. > */ >=20 > It seems that this source code is more recent than the images for the SD = card and kernel in=20 > http://9p.io/sources/contrib/miller/ - I'll try building a kernel based o= n the updated sources. >=20 > - Michael >=20 >=20 >> On 15 Jan 2021, at 23:32, Bakul Shah wrote: >>=20 >> Can you netboot Linux followed by netbooting Paln9 and have a working US= B? >>=20 >>> On Jan 15, 2021, at 1:17 PM, Michael Engel wrot= e: >>>=20 >>> Hi, >>>=20 >>> I didn't test Plan 9 on my RPi 400 so far, but I think the reason for t= he USB problems=20 >>> is the following: >>>=20 >>> The Raspberry Pi 400 (along with the Compute Module 4 and the 8 GB RAM = version=20 >>> of the RPI4) uses a new stepping C0 of the BCM2711. This version does n= ot have a=20 >>> dedicated EEPROM for the firmware of the xHCI USB controller and needs = an=20 >>> additional property mailbox call for loading the xHCI firmware after PC= Ie reset.=20 >>>=20 >>> Some code to load the firmware can be found in the circle bare-metal li= brary (l. 88ff): >>> https://github.com/rsta2/circle/blob/Step42.1/lib/usb/xhcidevice.cpp >>>=20 >>> -- Michael >>>=20 >>>=20 >>>> On 15 Jan 2021, at 20:54, Mack Wallace wrote: >>>>=20 >>>> I took that microSD card that has the bootable image without USB and p= ut it into a traditional Pi4. It boots on that without a problem and has mo= use and keyboard. I notices that after the additional CPU cores are detecte= d, that is mentions usb/hub=E2=80=A6 usb/kbd=E2=80=A6. The image when boot= ing on the Pi 400 never provides those messages. >>>>=20 >>>> Regards, >>>>=20 >>>> Mack=20 >>>>=20 >>>>> On Jan 15, 2021, at 1:44 PM, Mack Wallace wr= ote: >>>>>=20 >>>>> Dear Skip, >>>>>=20 >>>>> That pushed the ball forward significantly, but I still have issues. = (But thank you, every little advancement helps.) So with that flag, I was a= ble to get Richard=E2=80=99s port to boot into Glenda=E2=80=99s account (sh= owing acme, faces, stats, etc). However, I do not seem to have any USB; no = mouse; nor keyboard. Stats is moving on the screen, so things are not too l= ocked up. I did try rebooting with an external keyboard and another mouse. = Still nothing. The external keyboard doesn=E2=80=99t respond to anything (n= o caps lock nor num lock.) One mouse is in the USB 2.0 port, another and th= e external keyboard are in the USB 3.0 ports.=20 >>>>>=20 >>>>> on boot, I see the following: >>>>> usbxhci: 0x1106 0x3483 port 600000000 size 0x1000 irq0 >>>>> #u/usb/ep1.0: xhci port 0x0 irq 0 >>>>>=20 >>>>> The line before is #l for the network, >>>>> The line after is the detection of the other three cores. >>>>>=20 >>>>> The changing of the enable_gic=3D1 on the 9front image seemed to have= to effect. >>>>>=20 >>>>> Thanks again! >>>>>=20 >>>>> Mack >>>>>=20 >>>>>=20 >>>>> On Jan 14, 2021, at 8:15 PM, Skip Tavakkolian wrote: >>>>>>=20 >>>>>> I'm using a RPi400 with Richard's port. I'm netbooting without issue= s and up for days. The only issue I had was forgetting to set 'enable_gic= =3D1' as Richard instructed in the sources. Pi4 works ok without it, pi400 = doesn't. >>>>>>=20 >>>>>>=20 >>>>>> On Thu, Jan 14, 2021, 3:39 PM Mack Wallace = wrote: >>>>>> Thank you for the reply Stuart, but no luck. >>>>>>=20 >>>>>> I did download Mr. Miller=E2=80=99s image. It would not boot at all = until I replaced the files that you mention, but the kernel in that image l= ocks up after detecting the fourth core of the CPU. However, from that fail= ure I learned that those files, (start_cd.elf, start4cd.elf, fixup_cd.dat, = fixup4cd.dat) are necessary for the Pi to boot, and that those with the boo= tcode.bin and presumably, but it doesn=E2=80=99t seem to matter whether I u= se bcm2711-rpi-4-b.dtb or bcm2711-rpi-400.dtb - the dtbs are vital to the p= rocess. - and that all those files simply need to be copied into the fat pa= rtition/boot directory. >>>>>>=20 >>>>>> So I burned another image (actually many, trying different SD cards,= and different configurations, older kernels, etc) and replaced all the fil= es I=E2=80=99ve mentioned with the ones from https://github.com/raspberrypi= /firmware/tree/master/boot (hopefully that=E2=80=99s where I should get the= m). My most recent iteration just has the single error repeated: >>>>>>=20 >>>>>> sdhc: read error intr 2008002 stat 1fff0000 >>>>>>=20 >>>>>> This occurs many times. In the middle of these errors is=20 >>>>>>=20 >>>>>> /dev/sdM0: BCM SD Host Controller 02 Version 10 >>>>>>=20 >>>>>> then the error repeats itself over 50 times before printing out the = lines >>>>>> /dev/sdM0/data >>>>>> bootargs is (tcp, tls, il, local!device)[] >>>>>>=20 >>>>>> At no time during this process is the keyboard or mouse responsive. = Though the mouse icon did become visible during the boot process.=20 >>>>>>=20 >>>>>> I am hoping I am wrong, but I am thinking there is some sort of driv= er issue. At the very least, checking what media there is to mount, or read= ing the SD card. And then possibly for other things, but the former could b= e gumming up the works for everything else. >>>>>>=20 >>>>>>=20 >>>>>>> On Jan 14, 2021, at 6:05 PM, Stuart Morrow wrote: >>>>>>>=20 >>>>>>> Try copying the .dtb *and* the start4 and fixup4. >>>>=20 >>>> 9fans / 9fans / see discussions + participants + delivery options Perm= alink ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M3622a= a098d3909dba1f462c6 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription