From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: 9vx From: "Russ Cox" Date: Fri, 27 Jun 2008 04:07:33 -0700 MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080627110538.15AA31E8C35@holo.morphisms.net> Topicbox-Message-UUID: c71218aa-ead3-11e9-9d60-3106f5b1d025 a quick announcement: http://swtch.com/9vx/ i'll have time to say more later. russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> Date: Fri, 27 Jun 2008 06:18:12 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080627110538.15AA31E8C35@holo.morphisms.net> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8282_5460725.1214572692937" References: <20080627110538.15AA31E8C35@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c718b62e-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8282_5460725.1214572692937 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline Russ, This looks really compelling... I'll be trying it out for sure. I've had my share of aggravation keeping things running on "real hardware", and this may be the "time saver" I needed to keep up with Plan 9. Dave On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox wrote: > a quick announcement: > > http://swtch.com/9vx/ > > i'll have time to say more later. > > russ > > > ------=_Part_8282_5460725.1214572692937 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline Russ, 

This looks really compelling...  I'll be trying it out for sure.  I've had my share of aggravation keeping things running on "real hardware", and this may be the "time saver" I needed to keep up with Plan 9.

Dave

On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox <rsc@swtch.com> wrote:
a quick announcement:

       http://swtch.com/9vx/

i'll have time to say more later.

russ



------=_Part_8282_5460725.1214572692937-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> Date: Fri, 27 Jun 2008 06:40:08 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8361_26746462.1214574008685" References: <20080627110538.15AA31E8C35@holo.morphisms.net> <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7204f9c-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8361_26746462.1214574008685 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline Currently getting: 9vx panic: setsigsegv vx32 without alt stack On Mac OS X. On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach wrote: > Russ, > This looks really compelling... I'll be trying it out for sure. I've had > my share of aggravation keeping things running on "real hardware", and this > may be the "time saver" I needed to keep up with Plan 9. > > Dave > > > On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox wrote: > >> a quick announcement: >> >> http://swtch.com/9vx/ >> >> i'll have time to say more later. >> >> russ >> >> >> > ------=_Part_8361_26746462.1214574008685 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline Currently getting:

9vx panic: setsigsegv vx32 without alt stack

On Mac OS X.

On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach <leimy2k@gmail.com> wrote:
Russ, 

This looks really compelling...  I'll be trying it out for sure.  I've had my share of aggravation keeping things running on "real hardware", and this may be the "time saver" I needed to keep up with Plan 9.

Dave


On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox <rsc@swtch.com> wrote:
a quick announcement:

       http://swtch.com/9vx/

i'll have time to say more later.

russ




------=_Part_8361_26746462.1214574008685-- From mboxrd@z Thu Jan 1 00:00:00 1970 MIME-version: 1.0 Content-type: multipart/alternative; boundary="Boundary_(ID_RENfFIEh+G88ULSlrVIVtg)" Message-id: <3B168FDB-89AF-4135-80DF-57AA11F804DA@mac.com> From: Pietro Gagliardi To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> In-reply-to: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> Date: Fri, 27 Jun 2008 09:46:18 -0400 References: <20080627110538.15AA31E8C35@holo.morphisms.net> <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c72801f6-ead3-11e9-9d60-3106f5b1d025 --Boundary_(ID_RENfFIEh+G88ULSlrVIVtg) Content-type: text/plain; charset=US-ASCII; format=flowed; delsp=yes Content-transfer-encoding: 7BIT Same here. And for some reason I have to manually start X11. On Jun 27, 2008, at 9:40 AM, David Leimbach wrote: > Currently getting: > > 9vx panic: setsigsegv vx32 without alt stack > > On Mac OS X. > > On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach > wrote: > Russ, > > This looks really compelling... I'll be trying it out for sure. > I've had my share of aggravation keeping things running on "real > hardware", and this may be the "time saver" I needed to keep up with > Plan 9. > > Dave > > > On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox wrote: > a quick announcement: > > http://swtch.com/9vx/ > > i'll have time to say more later. > > russ > > > > --Boundary_(ID_RENfFIEh+G88ULSlrVIVtg) Content-type: text/html; charset=US-ASCII Content-transfer-encoding: quoted-printable
Same here. And for some = reason I have to manually start X11.

On Jun 27, 2008, = at 9:40 AM, David Leimbach wrote:

Currently = getting:

9vx panic: setsigsegv vx32 without alt = stack

On Mac OS X.

On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach = <leimy2k@gmail.com> = wrote:
Russ, 

This looks = really compelling...  I'll be trying it out for sure.  I've = had my share of aggravation keeping things running on "real hardware", = and this may be the "time saver" I needed to keep up with Plan 9.
=

Dave


On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox <rsc@swtch.com> = wrote:
a quick = announcement:

       http://swtch.com/9vx/

i'll have time to = say more later.

russ


=

=


= --Boundary_(ID_RENfFIEh+G88ULSlrVIVtg)-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: To: 9fans@9fans.net Date: Fri, 27 Jun 2008 09:49:29 -0400 From: a@9srv.net In-Reply-To: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="upas-ywffwhgwuvjxybabdthslgksla" Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c72d99b8-ead3-11e9-9d60-3106f5b1d025 This is a multi-part message in MIME format. --upas-ywffwhgwuvjxybabdthslgksla Content-Disposition: inline Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit same error here. invoke with -t and it'll work. investigating. lots of reading to do. this is pretty exciting. anthony --upas-ywffwhgwuvjxybabdthslgksla Content-Type: message/rfc822 Content-Disposition: inline Received: from gouda.swtch.com ([67.207.142.3]) by 9srv.net; Fri Jun 27 09:40:55 EDT 2008 Received: from localhost ([127.0.0.1] helo=gouda.swtch.com) by gouda.swtch.com with esmtp (Exim 4.67) (envelope-from <9fans-bounces@9fans.net>) id 1KCEBP-0005lv-4H; Fri, 27 Jun 2008 13:40:11 +0000 Received: from py-out-1112.google.com ([64.233.166.181]) by gouda.swtch.com with esmtp (Exim 4.67) (envelope-from ) id 1KCEBN-0005lq-8Q for 9fans@9fans.net; Fri, 27 Jun 2008 13:40:09 +0000 Received: by py-out-1112.google.com with SMTP id f47so109973pye.6 for <9fans@9fans.net>; Fri, 27 Jun 2008 06:40:09 -0700 (PDT) Received: by 10.114.169.20 with SMTP id r20mr1313121wae.198.1214574008678; Fri, 27 Jun 2008 06:40:08 -0700 (PDT) Received: by 10.115.92.7 with HTTP; Fri, 27 Jun 2008 06:40:08 -0700 (PDT) Message-ID: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> Date: Fri, 27 Jun 2008 06:40:08 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8361_26746462.1214574008685" References: <20080627110538.15AA31E8C35@holo.morphisms.net> <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> Subject: Re: [9fans] 9vx X-BeenThere: 9fans@9fans.net X-Mailman-Version: 2.1.9 Precedence: list Reply-To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> List-Id: Fans of the OS Plan 9 from Bell Labs <9fans.9fans.net> List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Sender: 9fans-bounces@9fans.net Errors-To: 9fans-bounces+a=9srv.net@9fans.net ------=_Part_8361_26746462.1214574008685 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline Currently getting: 9vx panic: setsigsegv vx32 without alt stack On Mac OS X. On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach wrote: > Russ, > This looks really compelling... I'll be trying it out for sure. I've had > my share of aggravation keeping things running on "real hardware", and this > may be the "time saver" I needed to keep up with Plan 9. > > Dave > > > On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox wrote: > >> a quick announcement: >> >> http://swtch.com/9vx/ >> >> i'll have time to say more later. >> >> russ >> >> >> > ------=_Part_8361_26746462.1214574008685 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline Currently getting:

9vx panic: setsigsegv vx32 without alt stack

On Mac OS X.

On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach <leimy2k@gmail.com> wrote:
Russ, 

This looks really compelling...  I'll be trying it out for sure.  I've had my share of aggravation keeping things running on "real hardware", and this may be the "time saver" I needed to keep up with Plan 9.

Dave


On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox <rsc@swtch.com> wrote:
a quick announcement:

       http://swtch.com/9vx/

i'll have time to say more later.

russ




------=_Part_8361_26746462.1214574008685-- --upas-ywffwhgwuvjxybabdthslgksla-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: Date: Fri, 27 Jun 2008 16:49:59 +0300 From: "Latchesar Ionkov" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <20080627110538.15AA31E8C35@holo.morphisms.net> <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7396acc-ead3-11e9-9d60-3106f5b1d025 Works fine on my laptop that runs MacOSX 10.4. Lucho On Fri, Jun 27, 2008 at 4:40 PM, David Leimbach wrote: > Currently getting: > 9vx panic: setsigsegv vx32 without alt stack > On Mac OS X. > On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach wrote: >> >> Russ, >> This looks really compelling... I'll be trying it out for sure. I've had >> my share of aggravation keeping things running on "real hardware", and this >> may be the "time saver" I needed to keep up with Plan 9. >> Dave >> >> On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox wrote: >>> >>> a quick announcement: >>> >>> http://swtch.com/9vx/ >>> >>> i'll have time to say more later. >>> >>> russ >>> >>> >> > > From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Fri, 27 Jun 2008 06:50:02 -0700 In-Reply-To: <3B168FDB-89AF-4135-80DF-57AA11F804DA@mac.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080627134806.3112F1E8C53@holo.morphisms.net> Topicbox-Message-UUID: c745116a-ead3-11e9-9d60-3106f5b1d025 > And for some reason I have to manually start X11. Welcome to OS X. Russ From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Fri, 27 Jun 2008 06:52:00 -0700 In-Reply-To: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080627135004.F19CE1E8C54@holo.morphisms.net> Topicbox-Message-UUID: c74d3566-ead3-11e9-9d60-3106f5b1d025 > Currently getting: > 9vx panic: setsigsegv vx32 without alt stack Do you have strace installed (is there one?) on OS X? Can you run it with the -g (disable gui) flag under strace? Thanks. Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270656t773c8093wb2b889b328f01194@mail.gmail.com> Date: Fri, 27 Jun 2008 06:56:46 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <3B168FDB-89AF-4135-80DF-57AA11F804DA@mac.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8483_25105375.1214575006890" References: <20080627110538.15AA31E8C35@holo.morphisms.net> <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <3B168FDB-89AF-4135-80DF-57AA11F804DA@mac.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7576cd4-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8483_25105375.1214575006890 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline On Fri, Jun 27, 2008 at 6:46 AM, Pietro Gagliardi wrote: > Same here. And for some reason I have to manually start X11. > X11 starts up for me ok. But then my xterms don't have the ability to deal with capital letters for some reason. > > On Jun 27, 2008, at 9:40 AM, David Leimbach wrote: > > Currently getting: > 9vx panic: setsigsegv vx32 without alt stack > > On Mac OS X. > > On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach wrote: > >> Russ, >> This looks really compelling... I'll be trying it out for sure. I've had >> my share of aggravation keeping things running on "real hardware", and this >> may be the "time saver" I needed to keep up with Plan 9. >> >> Dave >> >> >> On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox wrote: >> >>> a quick announcement: >>> >>> http://swtch.com/9vx/ >>> >>> i'll have time to say more later. >>> >>> russ >>> >>> >>> >> > > ------=_Part_8483_25105375.1214575006890 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline

On Fri, Jun 27, 2008 at 6:46 AM, Pietro Gagliardi <pietro10@mac.com> wrote:
Same here. And for some reason I have to manually start X11.

X11 starts up for me ok.  But then my xterms don't have the ability to deal with capital letters for some reason.


 

On Jun 27, 2008, at 9:40 AM, David Leimbach wrote:

Currently getting:

9vx panic: setsigsegv vx32 without alt stack

On Mac OS X.

On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach <leimy2k@gmail.com> wrote:
Russ, 

This looks really compelling...  I'll be trying it out for sure.  I've had my share of aggravation keeping things running on "real hardware", and this may be the "time saver" I needed to keep up with Plan 9.

Dave


On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox <rsc@swtch.com> wrote:
a quick announcement:

       http://swtch.com/9vx/

i'll have time to say more later.

russ






------=_Part_8483_25105375.1214575006890-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270657t7ea43edam37392e8b5b20c771@mail.gmail.com> Date: Fri, 27 Jun 2008 06:57:14 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8487_23750795.1214575034946" References: <20080627110538.15AA31E8C35@holo.morphisms.net> <3e1162e60806270618v2761ae70lbb8ac03b21be8779@mail.gmail.com> <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c75ddeac-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8487_23750795.1214575034946 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline I've got 10.5 On Fri, Jun 27, 2008 at 6:49 AM, Latchesar Ionkov wrote: > Works fine on my laptop that runs MacOSX 10.4. > > Lucho > > On Fri, Jun 27, 2008 at 4:40 PM, David Leimbach wrote: > > Currently getting: > > 9vx panic: setsigsegv vx32 without alt stack > > On Mac OS X. > > On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach > wrote: > >> > >> Russ, > >> This looks really compelling... I'll be trying it out for sure. I've > had > >> my share of aggravation keeping things running on "real hardware", and > this > >> may be the "time saver" I needed to keep up with Plan 9. > >> Dave > >> > >> On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox wrote: > >>> > >>> a quick announcement: > >>> > >>> http://swtch.com/9vx/ > >>> > >>> i'll have time to say more later. > >>> > >>> russ > >>> > >>> > >> > > > > > > ------=_Part_8487_23750795.1214575034946 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline I've got 10.5

On Fri, Jun 27, 2008 at 6:49 AM, Latchesar Ionkov <lucho@ionkov.net> wrote:
Works fine on my laptop that runs MacOSX 10.4.

   Lucho

On Fri, Jun 27, 2008 at 4:40 PM, David Leimbach <leimy2k@gmail.com> wrote:
> Currently getting:
> 9vx panic: setsigsegv vx32 without alt stack
> On Mac OS X.
> On Fri, Jun 27, 2008 at 6:18 AM, David Leimbach <leimy2k@gmail.com> wrote:
>>
>> Russ,
>> This looks really compelling...  I'll be trying it out for sure.  I've had
>> my share of aggravation keeping things running on "real hardware", and this
>> may be the "time saver" I needed to keep up with Plan 9.
>> Dave
>>
>> On Fri, Jun 27, 2008 at 4:07 AM, Russ Cox <rsc@swtch.com> wrote:
>>>
>>> a quick announcement:
>>>
>>>        http://swtch.com/9vx/
>>>
>>> i'll have time to say more later.
>>>
>>> russ
>>>
>>>
>>
>
>


------=_Part_8487_23750795.1214575034946-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270658m3136ac14t4af141708cd996fe@mail.gmail.com> Date: Fri, 27 Jun 2008 06:58:20 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080627135004.F19CE1E8C54@holo.morphisms.net> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8500_28602925.1214575100121" References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c76d5f1c-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8500_28602925.1214575100121 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline On Fri, Jun 27, 2008 at 6:52 AM, Russ Cox wrote: > > Currently getting: > > 9vx panic: setsigsegv vx32 without alt stack > > Do you have strace installed (is there one?) on OS X? > Can you run it with the -g (disable gui) flag > under strace? > No strace on Leopard. Dave > > Thanks. > Russ > > > ------=_Part_8500_28602925.1214575100121 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline

On Fri, Jun 27, 2008 at 6:52 AM, Russ Cox <rsc@swtch.com> wrote:
> Currently getting:
> 9vx panic: setsigsegv vx32 without alt stack

Do you have strace installed (is there one?) on OS X?
Can you run it with the -g (disable gui) flag
under strace?

No strace on Leopard.

Dave
 

Thanks.
Russ



------=_Part_8500_28602925.1214575100121-- From mboxrd@z Thu Jan 1 00:00:00 1970 Date: Fri, 27 Jun 2008 09:58:22 -0400 From: Venkatesh Srinivas To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Message-ID: <20080627135822.GA30036@companion-cube> References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii; format=flowed Content-Disposition: inline In-Reply-To: <20080627135004.F19CE1E8C54@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c773e4cc-ead3-11e9-9d60-3106f5b1d025 Works impressively well here. Even snarf/paste between host and 9vx is working. Did only the 9 kernel need modifications or did the applications binaries need to be recompiled as well? --vs From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: To: 9fans@9fans.net Date: Fri, 27 Jun 2008 09:58:37 -0400 From: a@9srv.net In-Reply-To: <20080627134806.3112F1E8C53@holo.morphisms.net> MIME-Version: 1.0 Content-Type: multipart/mixed; boundary="upas-eszdkzdwmkvfysgaorsjnpqvxp" Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7778258-ead3-11e9-9d60-3106f5b1d025 This is a multi-part message in MIME format. --upas-eszdkzdwmkvfysgaorsjnpqvxp Content-Disposition: inline Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I'm guessing here, but I think this was a reference to the fact that in 10.5, Apple did some work to make X11 start automatically when the first X11 app is run; maybe that's not working for pietro. Is everyone having a problem on OS X on 10.5? I am. OS X doesn't have strace; =E2=89=A410.4 has ktrace, 10.5 has dtrace. Anthony --upas-eszdkzdwmkvfysgaorsjnpqvxp Content-Type: message/rfc822 Content-Disposition: inline Received: from gouda.swtch.com ([67.207.142.3]) by 9srv.net; Fri Jun 27 09:50:36 EDT 2008 Received: from localhost ([127.0.0.1] helo=gouda.swtch.com) by gouda.swtch.com with esmtp (Exim 4.67) (envelope-from <9fans-bounces@9fans.net>) id 1KCEKy-00064v-EH; Fri, 27 Jun 2008 13:50:04 +0000 Received: from holo.morphisms.net ([216.254.78.15]) by gouda.swtch.com with esmtp (Exim 4.67) (envelope-from ) id 1KCEKx-00064n-6N for 9fans@9fans.net; Fri, 27 Jun 2008 13:50:03 +0000 Received: by holo.morphisms.net (Postfix, from userid 1002) id 3112F1E8C53; Fri, 27 Jun 2008 09:48:06 -0400 (EDT) To: 9fans@9fans.net From: "Russ Cox" Date: Fri, 27 Jun 2008 06:50:02 -0700 In-Reply-To: <3B168FDB-89AF-4135-80DF-57AA11F804DA@mac.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080627134806.3112F1E8C53@holo.morphisms.net> Subject: Re: [9fans] 9vx X-BeenThere: 9fans@9fans.net X-Mailman-Version: 2.1.9 Precedence: list Reply-To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> List-Id: Fans of the OS Plan 9 from Bell Labs <9fans.9fans.net> List-Unsubscribe: , List-Archive: List-Post: List-Help: List-Subscribe: , Sender: 9fans-bounces@9fans.net Errors-To: 9fans-bounces+a=9srv.net@9fans.net > And for some reason I have to manually start X11. Welcome to OS X. Russ --upas-eszdkzdwmkvfysgaorsjnpqvxp-- From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Fri, 27 Jun 2008 06:59:32 -0700 In-Reply-To: MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080627135737.22A051E8C4D@holo.morphisms.net> Topicbox-Message-UUID: c77fa8f2-ead3-11e9-9d60-3106f5b1d025 > same error here. invoke with -t and it'll work. investigating. I believe, though I can't see yet why that would matter in this case. I do suspect that the behavior of signal handlers in threaded programs changed between 10.4 and 10.5. You might try rebuilding from source (the binary was built on 10.4.10) just to see if that fixes the problem. Thanks for the reports. I'm sure there will be more bugs, especially in the OS X code, which is about a day old. Even on OS X 10.4, 9vx seems to chew most of available cpu while idling. (On my 2-processor machine, it was using 130% cpu.) Obviously it's not suposed to. I suspect a pthreads issue, but I haven't had time to look into it. Perhaps there are people out there more familiar with debugging on OS X than I am. Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <12611fc761e105e8b2711f919c032ff3@csplan9.rit.edu> To: 9fans@9fans.net Date: Fri, 27 Jun 2008 10:08:04 -0400 From: john@csplan9.rit.edu In-Reply-To: <20080627135822.GA30036@companion-cube> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7837392-ead3-11e9-9d60-3106f5b1d025 > Works impressively well here. Even snarf/paste between host and 9vx is > working. > > Did only the 9 kernel need modifications or did the applications > binaries need to be recompiled as well? > > --vs Seconded; everything works beautifully except that I'm not getting any network devices, it seems. John From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <599f06db0806270710j39af4d7v521e16740df81907@mail.gmail.com> Date: Fri, 27 Jun 2008 16:10:17 +0200 From: "Gorka Guardiola" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080627135822.GA30036@companion-cube> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <20080627135822.GA30036@companion-cube> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c786eb4e-ead3-11e9-9d60-3106f5b1d025 On Fri, Jun 27, 2008 at 3:58 PM, Venkatesh Srinivas wrote: > Works impressively well here. Even snarf/paste between host and 9vx is > working. > > Did only the 9 kernel need modifications or did the applications > binaries need to be recompiled as well? > > --vs > > 9vx requires no host kernel modifications or special privileges, and it runs unmodified plan9 386 binaries. -- - curiosity sKilled the cat From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <5af1d5df70fcd04750009e3a6ab68998@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Fri, 27 Jun 2008 10:11:01 -0400 In-Reply-To: <599f06db0806270710j39af4d7v521e16740df81907@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c793d480-ead3-11e9-9d60-3106f5b1d025 >> Did only the 9 kernel need modifications or did the applications >> binaries need to be recompiled as well? >> [...] > > 9vx requires no host kernel modifications or > special privileges, and it runs unmodified > plan9 386 binaries. but that doesn't answer the question. the plan 9 kernel was modified. how else would it provide access to the host's fs? - erik From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <80c6273283830706af6c8aaffe5077eb@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Fri, 27 Jun 2008 10:12:54 -0400 In-Reply-To: <12611fc761e105e8b2711f919c032ff3@csplan9.rit.edu> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7977658-ead3-11e9-9d60-3106f5b1d025 > Seconded; everything works beautifully except that I'm not getting > any network devices, it seems. there's not access to the network device per ce, but the network works fine for me. this is what i needed to do to connect to plan 9 networks 1. edit /lib/ndb/auth and /lib/ndb/local as appropriate. 2. rm /net/cs; ndb/cs 3. auth/factotum 4. cpu -h $host - erik From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Fri, 27 Jun 2008 07:19:04 -0700 In-Reply-To: <12611fc761e105e8b2711f919c032ff3@csplan9.rit.edu> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080627141709.3307A1E8C2B@holo.morphisms.net> Topicbox-Message-UUID: c79bebde-ead3-11e9-9d60-3106f5b1d025 > Seconded; everything works beautifully except that I'm not getting > any network devices, it seems. Perhaps bind -b '#I' /net That should be happening automatically, but hey, you never know. If files in /net exist, could you give more details? > Did only the 9 kernel need modifications or did the applications > binaries need to be recompiled as well? The user binaries are unmodified native 386 binaries. Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> Date: Fri, 27 Jun 2008 07:21:59 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080627135004.F19CE1E8C54@holo.morphisms.net> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8666_1507545.1214576519647" References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c79faff8-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8666_1507545.1214576519647 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline On Fri, Jun 27, 2008 at 6:52 AM, Russ Cox wrote: > > Currently getting: > > 9vx panic: setsigsegv vx32 without alt stack > > Do you have strace installed (is there one?) on OS X? > Can you run it with the -g (disable gui) flag > under strace? Without GUI I get a pretty good looking start :-) [7:00] dave(mt64):..p/9vx-0.10 %> ./9vx.OSX -g -u glenda init: starting /bin/rc bind: #S: unknown device in # filename upas/fs: '/bin/upas/fs' does not exist #m/mousectl: rc: can't open: jmk added reentrancy for threads init: rc exit status: rc 5: error init: starting /bin/rc % > > > Thanks. > Russ > > > ------=_Part_8666_1507545.1214576519647 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline

On Fri, Jun 27, 2008 at 6:52 AM, Russ Cox <rsc@swtch.com> wrote:
> Currently getting:
> 9vx panic: setsigsegv vx32 without alt stack

Do you have strace installed (is there one?) on OS X?
Can you run it with the -g (disable gui) flag
under strace?

Without GUI I get a pretty good looking start :-)

[7:00] dave(mt64):..p/9vx-0.10 %> ./9vx.OSX -g -u glenda

init: starting /bin/rc
bind: #S: unknown device in # filename
upas/fs: '/bin/upas/fs' does not exist
#m/mousectl: rc: can't open: jmk added reentrancy for threads
init: rc exit status: rc 5: error

init: starting /bin/rc
% 

 


Thanks.
Russ



------=_Part_8666_1507545.1214576519647-- From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Fri, 27 Jun 2008 07:29:24 -0700 In-Reply-To: <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080627142729.283D01E8C2B@holo.morphisms.net> Topicbox-Message-UUID: c7a3dd1c-ead3-11e9-9d60-3106f5b1d025 > Without GUI I get a pretty good looking start :-) That's good, although too bad it doesn't help with the X11 problem. Rebuilding from source is the first thing I'd try. After that, someone needs to learn how to get a system call trace from a multithreaded program on OS X. Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-Id: <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> From: Pat Hacker To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> In-Reply-To: <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit Mime-Version: 1.0 (Apple Message framework v924) Date: Fri, 27 Jun 2008 07:30:03 -0700 References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7a7cdaa-ead3-11e9-9d60-3106f5b1d025 on OSX 10.5.3 % ./9vx.OSX -1g -u glenda init: starting /bin/rc bind: #S: unknown device in # filename upas/fs: '/bin/upas/fs' does not exist #m/mousectl: rc: can't open: jmk added reentrancy for threads init: rc exit status: rc 4: error From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> Date: Fri, 27 Jun 2008 16:32:22 +0200 From: "Francisco J Ballesteros" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7abd90e-ead3-11e9-9d60-3106f5b1d025 MacOSX 10.5, running it with -t works fine here, including GUI. On Fri, Jun 27, 2008 at 4:30 PM, Pat Hacker wrote: > on OSX 10.5.3 > % ./9vx.OSX -1g -u glenda > > init: starting /bin/rc > bind: #S: unknown device in # filename > upas/fs: '/bin/upas/fs' does not exist > #m/mousectl: rc: can't open: jmk added reentrancy for threads > init: rc exit status: rc 4: error > > > > From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270734q19223002wd1e937fd79b7391e@mail.gmail.com> Date: Fri, 27 Jun 2008 07:34:36 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8733_3856635.1214577277119" References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7b018ac-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8733_3856635.1214577277119 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline Confirmed! That works great! On Fri, Jun 27, 2008 at 7:32 AM, Francisco J Ballesteros wrote: > MacOSX 10.5, > > running it with -t works fine here, including GUI. > > > On Fri, Jun 27, 2008 at 4:30 PM, Pat Hacker wrote: > > on OSX 10.5.3 > > % ./9vx.OSX -1g -u glenda > > > > init: starting /bin/rc > > bind: #S: unknown device in # filename > > upas/fs: '/bin/upas/fs' does not exist > > #m/mousectl: rc: can't open: jmk added reentrancy for threads > > init: rc exit status: rc 4: error > > > > > > > > > > ------=_Part_8733_3856635.1214577277119 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline Confirmed!  That works great!


On Fri, Jun 27, 2008 at 7:32 AM, Francisco J Ballesteros <nemo@lsub.org> wrote:
MacOSX 10.5,

running it with -t works fine here, including GUI.


On Fri, Jun 27, 2008 at 4:30 PM, Pat Hacker <pat@picoworks.com> wrote:
> on OSX 10.5.3
> % ./9vx.OSX -1g -u glenda
>
> init: starting /bin/rc
> bind: #S: unknown device in # filename
> upas/fs: '/bin/upas/fs' does not exist
> #m/mousectl: rc: can't open: jmk added reentrancy for threads
> init: rc exit status: rc 4: error
>
>
>
>


------=_Part_8733_3856635.1214577277119-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <14ec7b180806270739n46652d6r6df8d7d851fb2a1@mail.gmail.com> Date: Fri, 27 Jun 2008 08:39:35 -0600 From: "andrey mirtchovski" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7b552b8-ead3-11e9-9d60-3106f5b1d025 confirmed for 10.5.3. On Fri, Jun 27, 2008 at 8:32 AM, Francisco J Ballesteros wrote: > MacOSX 10.5, > > running it with -t works fine here, including GUI. > > From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270745v48bcf7r60a7f3baaf0eca1e@mail.gmail.com> Date: Fri, 27 Jun 2008 07:45:09 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <14ec7b180806270739n46652d6r6df8d7d851fb2a1@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8816_16372429.1214577909134" References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> <14ec7b180806270739n46652d6r6df8d7d851fb2a1@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7be7b22-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8816_16372429.1214577909134 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline I'm noticing I can't type a colon ":" but semicolon works :-) On Fri, Jun 27, 2008 at 7:39 AM, andrey mirtchovski wrote: > confirmed for 10.5.3. > > On Fri, Jun 27, 2008 at 8:32 AM, Francisco J Ballesteros > wrote: > > MacOSX 10.5, > > > > running it with -t works fine here, including GUI. > > > > > > ------=_Part_8816_16372429.1214577909134 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline I'm noticing I can't type a colon ":" but semicolon works :-)



On Fri, Jun 27, 2008 at 7:39 AM, andrey mirtchovski <mirtchovski@gmail.com> wrote:
confirmed for 10.5.3.

On Fri, Jun 27, 2008 at 8:32 AM, Francisco J Ballesteros <nemo@lsub.org> wrote:
> MacOSX 10.5,
>
> running it with -t works fine here, including GUI.
>
>


------=_Part_8816_16372429.1214577909134-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806270747u43754020h6e597bc737082554@mail.gmail.com> Date: Fri, 27 Jun 2008 07:47:18 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <3e1162e60806270745v48bcf7r60a7f3baaf0eca1e@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8836_30281837.1214578038613" References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> <14ec7b180806270739n46652d6r6df8d7d851fb2a1@mail.gmail.com> <3e1162e60806270745v48bcf7r60a7f3baaf0eca1e@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7cb091e-ead3-11e9-9d60-3106f5b1d025 ------=_Part_8836_30281837.1214578038613 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline In fact, no capital letters work. On Fri, Jun 27, 2008 at 7:45 AM, David Leimbach wrote: > I'm noticing I can't type a colon ":" but semicolon works :-) > > > > On Fri, Jun 27, 2008 at 7:39 AM, andrey mirtchovski > wrote: > >> confirmed for 10.5.3. >> >> On Fri, Jun 27, 2008 at 8:32 AM, Francisco J Ballesteros >> wrote: >> > MacOSX 10.5, >> > >> > running it with -t works fine here, including GUI. >> > >> > >> >> > ------=_Part_8836_30281837.1214578038613 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline In fact, no capital letters work.

On Fri, Jun 27, 2008 at 7:45 AM, David Leimbach <leimy2k@gmail.com> wrote:
I'm noticing I can't type a colon ":" but semicolon works :-)



On Fri, Jun 27, 2008 at 7:39 AM, andrey mirtchovski <mirtchovski@gmail.com> wrote:
confirmed for 10.5.3.

On Fri, Jun 27, 2008 at 8:32 AM, Francisco J Ballesteros <nemo@lsub.org> wrote:
> MacOSX 10.5,
>
> running it with -t works fine here, including GUI.
>
>



------=_Part_8836_30281837.1214578038613-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <14ec7b180806270755y26158d50s697dd927c5c4a30e@mail.gmail.com> Date: Fri, 27 Jun 2008 08:55:51 -0600 From: "andrey mirtchovski" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <14ec7b180806270739n46652d6r6df8d7d851fb2a1@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: base64 Content-Disposition: inline References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> <14ec7b180806270739n46652d6r6df8d7d851fb2a1@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7d70124-ead3-11e9-9d60-3106f5b1d025 Zm91bmQgc29tZXRoaW5nIHRoYXQgY3Jhc2hlcyBjb25zaXN0ZW50bHk6IHRoZSB4c2NyIGhhY2tz IHRoYXQgdXNlIHRocmVhZHMuCgp0aGlzIGZyb20gdGhlIDl2eCBjb25zb2xlOgoKNzgzIHN1YnN0 cmF0ZSBmYXVsdCAweDlhMSBubyBzZWdtZW50CnNlZ21lbnQgMHhmMDAwMDAwIDB4MTAwMDAwMDAK c2VnbWVudCAweDEwMDAgMHgxZTAwMApzZWdtZW50IDB4MWUwMDAgMHgyNzAwMApzZWdtZW50IDB4 MjcwMDAgMHgyNTEwMDAKNzgzIHN1YnN0cmF0ZTogdW5oYW5kbGVkIGZhdWx0IHZhPTlhMSBbMTAw MDlhMV0gZWlwPTEzZjA3CmNwdTA6IHJlZ2lzdGVycyBmb3Igc3Vic3RyYXRlIDc4MwpGTEFHUz0w IFRSQVA9MCBFQ09ERT0wIFBDPTEzRjA3IFVTUD0zNzMwQwogIEFYIDAwMDAwMzBGICBCWCAwMDAw MDAzMSAgQ1ggMDAwMjZCMDggIERYIDAwMDAwMzBGCiAgU0kgMDAwMDAzMEYgIERJIDAwMDM3MzA4 ICBCUCAwMDAwMDAwMAo3ODUgc3RyYW5nZTogdW5oYW5kbGVkIGZhdWx0IHZhPTM3NDI0MDAwIFsz ODQyNDAwMF0gZWlwPTE1MDE0CmNwdTA6IHJlZ2lzdGVycyBmb3Igc3RyYW5nZSA3ODUKRkxBR1M9 MCBUUkFQPTAgRUNPREU9MCBQQz0xNTAxNCBVU1A9Mjg1OTQKICBBWCAwMDAwMDAwMSAgQlggODND MzNDQzQgIENYIDAwMDIwNjFDICBEWCAwMDAwMDMxMQogIFNJIDAwMDAwMzExICBESSAwMDAyODU5 MCAgQlAgMDAwMDAwMDAKCmluc2lkZSA5dng6CgolIHhzY3Ivc3Vic3RyYXRlCnN1YnN0cmF0ZSA3 ODM6IHN4c2NydWljaWRlOiBzeXM6IHRyYXA6IHBhZ2UgZmF1bHQgcGM9MHgwMDAxM2YwNwolIHhz Y3Ivc3RyYW5nZQpzdHJhbmdlIDc4NTogc3VpY2lkZTogc3lzOiB0cmFwOiBwYWdlIGZhdWx0IHBj PTB4MDAwMTUwMTQKJSBhY2lkIDc4NQovcHJvYy83ODUvdGV4dDozODYgcGxhbiA5IGV4ZWN1dGFi bGUKL3N5cy9saWIvYWNpZC9wb3J0Ci9zeXMvbGliL2FjaWQvMzg2CmFjaWQ6IGxzdGsoKQp0aHJl YWRleGl0c2FsbChleGl0c3RyPTB4MWVlMjEpKzB4YzkgL3N5cy9zcmMvbGlidGhyZWFkL2V4aXQu Yzo0OQoJbXlwaWQ9MHgzMTEKCW5waWQ9MHgwCglwaWQ9MHgxYzRhYwoJaT0weDkxYjEKdGhyZWFk bWFpbihhcmd2PTB4ZmZmZmZiMCxhcmdjPTB4MCkrMHhlZSAvdXNyL2FuZHJleS94c2NyL3N0cmFu Z2UuYzo0MDQKCV9hcmdjPTB4ZmVmZWZlZmUKCV9hcmdzPTB4ZmVmZWZlZmUKCW09MHgwCm1haW5s YXVuY2hlcihhcmc9MHgyNWNjMCkrMHgxOCAvc3lzL3NyYy9saWJ0aHJlYWQvbWFpbi5jOjU4Cmxh dW5jaGVyMzg2KGFyZz0weDI1Y2MwLGY9MHgxNDk1YykrMHgxMCAvc3lzL3NyYy9saWJ0aHJlYWQv Mzg2LmM6MTAKMHhmZWZlZmVmZSA/ZmlsZT86MAphY2lkOiAECmVjaG8ga2lsbCA+IC9wcm9jLzc4 NS9jdGwKJSBhY2lkIDc4MwovcHJvYy83ODMvdGV4dDozODYgcGxhbiA5IGV4ZWN1dGFibGUKL3N5 cy9saWIvYWNpZC9wb3J0Ci9zeXMvbGliL2FjaWQvMzg2CmFjaWQ6IGxzdGsoKQp0aHJlYWRleGl0 c2FsbChleGl0c3RyPTB4MWU3Y2QpKzB4YzkgL3N5cy9zcmMvbGlidGhyZWFkL2V4aXQuYzo0OQoJ bXlwaWQ9MHgzMGYKCW5waWQ9MHgwCglwaWQ9MHgxZTRmYwoJaT0weDgxYWEKc2NyZWVuaGFjaygp KzB4MTVhIC91c3IvYW5kcmV5L3hzY3Ivc3Vic3RyYXRlLmM6MzgxCgltYXhfY3ljbGVzPTB4N2Qw Cgl0ZW1weD0weDYzCnRocmVhZG1haW4oYXJndj0weGZmZmZmYjAsYXJnYz0weDApKzB4Y2UgL3Vz ci9hbmRyZXkveHNjci9zdWJzdHJhdGUuYzo0NDgKCV9hcmdjPTB4ZmVmZWZlZmUKCV9hcmdzPTB4 ZmVmZWZlZmUKbWFpbmxhdW5jaGVyKGFyZz0weDM0YTYwKSsweDE4IC9zeXMvc3JjL2xpYnRocmVh ZC9tYWluLmM6NTgKbGF1bmNoZXIzODYoYXJnPTB4MzRhNjAsZj0weDEzODRmKSsweDEwIC9zeXMv c3JjL2xpYnRocmVhZC8zODYuYzoxMAoweGZlZmVmZWZlID9maWxlPzowCmFjaWQ6CiUgeHNjci9z d2lybApzd2lybCA4MDM6IHN1aWNpZGU6IHN5czogdHJhcDogcGFnZSBmYXVsdCBwYz0weDAwMDE1 NDZhCiUgeHNjci96b29tCnpvb20gODA1OiBzdWljaWRlOiBzeXM6IHRyYXA6IHBhZ2UgZmF1bHQg cGM9MHgwMDAxMDhkMgolCg== From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> Date: Fri, 27 Jun 2008 07:57:22 -0700 From: "ron minnich" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080627110538.15AA31E8C35@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <20080627110538.15AA31E8C35@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7dda718-ead3-11e9-9d60-3106f5b1d025 building on x86 64 bit. first issue is that I get this:make: vx32-gcc: Command not found second is that I get this: gcc -Ilibvx32 -c -g -O3 -MD -std=gnu99 -I. -o libvx32/linux.o libvx32/linux.c libvx32/linux.c: In function `vx32_sighandler': libvx32/linux.c:254: error: structure has no member named `rip' libvx32/linux.c:303: error: structure has no member named `rip' make: *** [libvx32/linux.o] Error 1 which makes sense I guess as we're not 64 bit and IIRC it has a different name. Did you want -m32 on those files? I don't understand this well enough yet to know. But lguest just broke big time so if I can get this to work, I'm moving! thanks ron From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <13426df10806270814k8aec549q139069e008b4566a@mail.gmail.com> Date: Fri, 27 Jun 2008 08:14:19 -0700 From: "ron minnich" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <20080627110538.15AA31E8C35@holo.morphisms.net> <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c7e2605a-ead3-11e9-9d60-3106f5b1d025 On Fri, Jun 27, 2008 at 7:57 AM, ron minnich wrote: > building on x86 64 bit. > > first issue is that I get this:make: vx32-gcc: Command not found > > second is that I get this: > gcc -Ilibvx32 -c -g -O3 -MD -std=gnu99 -I. -o libvx32/linux.o libvx32/linux.c > libvx32/linux.c: In function `vx32_sighandler': > libvx32/linux.c:254: error: structure has no member named `rip' > libvx32/linux.c:303: error: structure has no member named `rip' > make: *** [libvx32/linux.o] Error 1 yeah. The rip thing is fixed for sigcontext in linux.c, but not in this: // VX32 CPU state struct vxcpu { uint32_t reg[8]; uint32_t eip; uint32_t eflags; uint32_t traperr; uint32_t trapva; // cr2 }; So the #defines in libvx32/linux.c fix things for sigcontext and break things for vxcpu struct. Hmm. It's rather sleazy but I put #undef eip at linux.c line 252 and it builds. Now I get a link error: libvx32/libvx32.a(rts.o)(.text+0x99): In function `vxrun_lookup_backpatch': libvx32/rts.S:127: undefined reference to `VXEMU_RETPTR' libvx32/libvx32.a(rts.o)(.text+0x10d): In function `vxrun_lookup_indirect': libvx32/rts.S:214: undefined reference to `VXEMU_RETPTR' libvx32/libvx32.a(rts.o)(.text+0x13e): In function `vxrun_gentrap': libvx32/rts.S:232: undefined reference to `VXEMU_RETPTR' libvx32/libvx32.a(run64.o)(.text+0x2e): In function `vxrun': libvx32/run64.S:56: undefined reference to `VXEMU_RUNPTR' libvx32/libvx32.a(run64.o)(.text+0x60):libvx32/run64.S:82: undefined reference to `VXEMU_RUNPTR' collect2: ld returned 1 exit status make: exit 2 more as I hit it. This is a little bit easier than building lguest modules. Ah, this is going to be fun! I just shorted vmware. I'm gonna be rich, I tell you! Rich! ron From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Fri, 27 Jun 2008 08:17:22 -0700 In-Reply-To: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080627151526.76D701E8C2B@holo.morphisms.net> Topicbox-Message-UUID: c7e675a0-ead3-11e9-9d60-3106f5b1d025 > building on x86 64 bit. > > first issue is that I get this:make: vx32-gcc: Command not found > > second is that I get this: > gcc -Ilibvx32 -c -g -O3 -MD -std=gnu99 -I. -o libvx32/linux.o libvx32/linux.c > libvx32/linux.c: In function `vx32_sighandler': > libvx32/linux.c:254: error: structure has no member named `rip' > libvx32/linux.c:303: error: structure has no member named `rip' > make: *** [libvx32/linux.o] Error 1 > > which makes sense I guess as we're not 64 bit and IIRC it has a different name. > > Did you want -m32 on those files? I don't understand this well enough > yet to know. > > But lguest just broke big time so if I can get this to work, I'm moving! make 9vx/9vx will build only 9vx and will not need vx32-gcc. if you make clean and then edit the top-level src/Makefrag file to add -m32 to the HOST_CFLAGS and then make 9vx/9vx you are likely to get a working binary. compiling in 64-bit mode is almost certainly not going to work; the plan 9 kernel code is very 32-bit here. and it would be very confused if its own pointers were 64-bit but the user code pointers were 32-bit. russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <14ec7b180806270831p4e7f5899ieae72e9f44350d99@mail.gmail.com> Date: Fri, 27 Jun 2008 09:31:14 -0600 From: "andrey mirtchovski" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <3e1162e60806270640p2e3f5a26ldff51e5eda1a7255@mail.gmail.com> <20080627135004.F19CE1E8C54@holo.morphisms.net> <3e1162e60806270721q29f26f20yf595694c84794a40@mail.gmail.com> <87EDB08B-6135-48B1-8BEA-AE62338B8B5E@picoworks.com> <8ccc8ba40806270732m4d21e14na8977b2dc0122a08@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c855dd1e-ead3-11e9-9d60-3106f5b1d025 Try running with -F (and no -t). It seems to work fine on my machine. andrey On Fri, Jun 27, 2008 at 8:32 AM, Francisco J Ballesteros wrote: > MacOSX 10.5, > > running it with -t works fine here, including GUI. > From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <5d375e920806270841k2a4439cdi614cdd68310dc928@mail.gmail.com> Date: Fri, 27 Jun 2008 17:41:36 +0200 From: Uriel To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <20080627110538.15AA31E8C35@holo.morphisms.net> <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c888c3fa-ead3-11e9-9d60-3106f5b1d025 What broke in lguest? seemed quite nice from what I have seen so far, just wondering because I was pondering using it for some projects. Not to mean anything against vx32/9vx which is quite damned awesome as far as I can see. uriel > But lguest just broke big time so if I can get this to work, I'm moving! > > thanks > > ron > > From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> Date: Fri, 27 Jun 2008 08:52:59 -0700 From: "ron minnich" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080627151526.76D701E8C2B@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c88fe45a-ead3-11e9-9d60-3106f5b1d025 This with a new untar, HOSTCFLAGS I added -m32 [rminnich@amd64 src]$ make 9vx/9vx make: vx32-gcc: Command not found make: vx32-gcc: Command not found make: *** No rule to make target `9vx/9vx'. Stop. OK, I can see that 9vx/9vx target in 9vx/Makefrag, but the alarm just went off and I gotta go pretend to work. More later. It would be nice to have this work on x86 64 :-) I do enjoy make sometimes. thanks ron From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <13426df10806270854yf8de62bm4071a687f507cd05@mail.gmail.com> Date: Fri, 27 Jun 2008 08:54:30 -0700 From: "ron minnich" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <5d375e920806270841k2a4439cdi614cdd68310dc928@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <20080627110538.15AA31E8C35@holo.morphisms.net> <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <5d375e920806270841k2a4439cdi614cdd68310dc928@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c89bba00-ead3-11e9-9d60-3106f5b1d025 On Fri, Jun 27, 2008 at 8:41 AM, Uriel wrote: > What broke in lguest? seemed quite nice from what I have seen so far, > just wondering because I was pondering using it for some projects. some things changed on the plan 9 side, and then on the lguest side, and I can no longer build a working kernel. I've kind of run out of patience with the linux kernel churn, so if vx32 works for me, I'm moving on :-) thanks ron From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> Date: Fri, 27 Jun 2008 10:39:42 -0700 From: "ron minnich" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c8d08ae6-ead3-11e9-9d60-3106f5b1d025 I'm on this 32 bit machine using vx32. Wow, nice. Boots like a bat. now all I want is my fossil and venti :-) This is really sweet. I think we've got an easy way to show people Plan 9 now. thanks Russ! ron From mboxrd@z Thu Jan 1 00:00:00 1970 MIME-version: 1.0 Content-transfer-encoding: 7BIT Content-type: text/plain; charset=US-ASCII; format=flowed; delsp=yes Message-id: <12E30932-B347-40A9-AD38-650FB093E200@mac.com> From: Pietro Gagliardi To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> In-reply-to: <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> Date: Fri, 27 Jun 2008 14:57:29 -0400 References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c94e85ae-ead3-11e9-9d60-3106f5b1d025 On Jun 27, 2008, at 1:39 PM, ron minnich wrote: > This is really sweet. I think we've got an easy way to show people > Plan 9 now. I agree: a self-contained 9 could really solve all my QEMU worries and boot CD nonsense! (No mouse detection, "kbd init failed" x infinity, inverse video - sorry) Now if only it could work without X11. I might try that. From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806271159l5ed9768cub20a9c5895e132c4@mail.gmail.com> Date: Fri, 27 Jun 2008 11:59:22 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_9977_15187462.1214593163059" References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c953ab60-ead3-11e9-9d60-3106f5b1d025 ------=_Part_9977_15187462.1214593163059 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline On Fri, Jun 27, 2008 at 10:39 AM, ron minnich wrote: > I'm on this 32 bit machine using vx32. Wow, nice. Boots like a bat. > > now all I want is my fossil and venti :-) > > This is really sweet. I think we've got an easy way to show people Plan 9 > now. > > thanks Russ! > > ron > > And uriel should be able to stop complaining about drawterm being redundant :-) Dave ------=_Part_9977_15187462.1214593163059 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline

On Fri, Jun 27, 2008 at 10:39 AM, ron minnich <rminnich@gmail.com> wrote:
I'm on this 32 bit machine using vx32. Wow, nice. Boots like a bat.

now all I want is my fossil and venti :-)

This is really sweet. I think we've got an easy way to show people Plan 9 now.

thanks Russ!

ron

And uriel should be able to stop complaining about drawterm being redundant :-)

Dave
------=_Part_9977_15187462.1214593163059-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <13426df10806271439s6e5092f6u188b7ac14b2453e6@mail.gmail.com> Date: Fri, 27 Jun 2008 14:39:05 -0700 From: "ron minnich" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <3e1162e60806271159l5ed9768cub20a9c5895e132c4@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> <3e1162e60806271159l5ed9768cub20a9c5895e132c4@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c981c702-ead3-11e9-9d60-3106f5b1d025 So i realized I'm being foolish w.r.t my comments on "i want my venti" in the 9vx directory dd if=/dev/zero of=arenas bs=1048576 count=whatever do for index and bloom follow venti instructions. voila. Venti. Rinse and repeat for fossil. oh man I love this 9vx. Time for tvx -- tiny vx -- no need for the H any more, as that stood for horrible :-) ron From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806271551t1e7e4a12g436f454bb65f7847@mail.gmail.com> Date: Fri, 27 Jun 2008 15:51:18 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <13426df10806271439s6e5092f6u188b7ac14b2453e6@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_10796_23256955.1214607078988" References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> <3e1162e60806271159l5ed9768cub20a9c5895e132c4@mail.gmail.com> <13426df10806271439s6e5092f6u188b7ac14b2453e6@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c9976102-ead3-11e9-9d60-3106f5b1d025 ------=_Part_10796_23256955.1214607078988 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline > > > oh man I love this 9vx. Indeed, this is truly excellent. ------=_Part_10796_23256955.1214607078988 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline

oh man I love this 9vx.

Indeed, this is truly excellent. 
------=_Part_10796_23256955.1214607078988-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: To: 9fans@9fans.net Date: Fri, 27 Jun 2008 16:13:15 -0700 From: Skip Tavakkolian <9nut@9netics.com> In-Reply-To: <20080627110538.15AA31E8C35@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c99cf16c-ead3-11e9-9d60-3106f5b1d025 this is fantastic. thank you Bryan and Russ. i've not had a chance to look through the sources. is a windows port feasible? > a quick announcement: > > http://swtch.com/9vx/ > > i'll have time to say more later. > > russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <77944785105ed99be5fe43150affc5b0@9netics.com> To: 9fans@9fans.net Date: Fri, 27 Jun 2008 16:24:42 -0700 From: Skip Tavakkolian <9nut@9netics.com> In-Reply-To: MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c9b9a6ae-ead3-11e9-9d60-3106f5b1d025 > i've not had a chance to look through the sources. is a windows port > feasible? i mean, any updates beyond what's on page 3 of the paper. From mboxrd@z Thu Jan 1 00:00:00 1970 From: "Brian L. Stuart" To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Date: Fri, 27 Jun 2008 23:29:43 +0000 Message-Id: <062720082329.407.486577E6000DAB200000019722243323629B0A02D2089B9A019C04040A0DBF9B9D0E9A9B9C040D@att.net> In-Reply-To: <13426df10806271439s6e5092f6u188b7ac14b2453e6@mail.gmail.com> References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> <3e1162e60806271159l5ed9768cub20a9c5895e132c4@mail.gmail.com> <13426df10806271439s6e5092f6u188b7ac14b2453e6@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c9c536ea-ead3-11e9-9d60-3106f5b1d025 > So i realized I'm being foolish w.r.t my comments on "i want my venti" > > in the 9vx directory > dd if=/dev/zero of=arenas bs=1048576 count=whatever > > do for index and bloom > follow venti instructions. > > voila. Venti. Rinse and repeat for fossil. I haven't tried this yet, but is there any reason you couldn't put block special files for disk partitions in the 9vx directory and put the arenas, etc there, assuming of course all the permissions were set right? I'll probably give it a try later tonight unless someone yells "Stop! You'll poke out your eye^W partition table." > oh man I love this 9vx. > > Time for tvx -- tiny vx -- no need for the H any more, as that stood > for horrible :-) This is seriously cool. I'm enough of a geezer that not too much excites me anymore. But today, I had fun reading the USENIX paper and thinking about how to use this. BLS From mboxrd@z Thu Jan 1 00:00:00 1970 MIME-version: 1.0 Content-transfer-encoding: 7BIT Content-type: text/plain; charset=US-ASCII; format=flowed; delsp=yes Message-id: <0C355162-729E-4CB5-BC93-8597A6E09E98@mac.com> From: Pietro Gagliardi To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> In-reply-to: Date: Fri, 27 Jun 2008 19:34:16 -0400 References: Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c9d6db84-ead3-11e9-9d60-3106f5b1d025 On Jun 27, 2008, at 7:13 PM, Skip Tavakkolian wrote: > i've not had a chance to look through the sources. is a windows port > feasible? If you call translating the X API to Win32 or C++ .NET feasible, then yes! I'm struggling to Cocoa-ize it. It seems like a much easier job than with drawterm. I believe the only folder you need to update is src/9vx/x11. It's seven files of pure evil. From mboxrd@z Thu Jan 1 00:00:00 1970 From: Dave Eckhardt To: 9fans@9fans.net In-Reply-To: <20080627110538.15AA31E8C35@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="us-ascii" Content-ID: <9485.1214610063.1@lunacy.ugrad.cs.cmu.edu> Date: Fri, 27 Jun 2008 19:41:03 -0400 Message-ID: <9486.1214610063@lunacy.ugrad.cs.cmu.edu> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c9db6dde-ead3-11e9-9d60-3106f5b1d025 libvx32/freebsd.c:20:2: warning: #warning "libvx32 and FreeBSD 5 and 6's libpthread are not compatible." I guess the priority of my "upgrade laptop's FreeBSD" thread has just increased. Dave Eckhardt From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806271652q2b7044f8m55746b8820582bf4@mail.gmail.com> Date: Fri, 27 Jun 2008 16:52:20 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <0C355162-729E-4CB5-BC93-8597A6E09E98@mac.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_10937_20948824.1214610740386" References: <0C355162-729E-4CB5-BC93-8597A6E09E98@mac.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c9e948e6-ead3-11e9-9d60-3106f5b1d025 ------=_Part_10937_20948824.1214610740386 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline On Fri, Jun 27, 2008 at 4:34 PM, Pietro Gagliardi wrote: > On Jun 27, 2008, at 7:13 PM, Skip Tavakkolian wrote: > >> i've not had a chance to look through the sources. is a windows port >> feasible? >> > If you call translating the X API to Win32 or C++ .NET feasible, then yes! > I'm struggling to Cocoa-ize it. It seems like a much easier job than with > drawterm. I'm no expert in Cocoa-ification, but am more than willing to test and help where and when I can (I have new father syndrome) > > > I believe the only folder you need to update is src/9vx/x11. It's seven > files of pure evil. > > > ------=_Part_10937_20948824.1214610740386 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline

On Fri, Jun 27, 2008 at 4:34 PM, Pietro Gagliardi <pietro10@mac.com> wrote:
On Jun 27, 2008, at 7:13 PM, Skip Tavakkolian wrote:
i've not had a chance to look through the sources.  is a windows port
feasible?
If you call translating the X API to Win32 or C++ .NET feasible, then yes! I'm struggling to Cocoa-ize it. It seems like a much easier job than with drawterm.

I'm no expert in Cocoa-ification, but am more than willing to test and help where and when I can (I have new father syndrome)
 


I believe the only folder you need to update is src/9vx/x11. It's seven files of pure evil.



------=_Part_10937_20948824.1214610740386-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806271652sa878e92x86fb36a91cb4ac47@mail.gmail.com> Date: Fri, 27 Jun 2008 16:52:56 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <9486.1214610063@lunacy.ugrad.cs.cmu.edu> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_10948_7643008.1214610776762" References: <20080627110538.15AA31E8C35@holo.morphisms.net> <9486.1214610063@lunacy.ugrad.cs.cmu.edu> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: c9fbaf90-ead3-11e9-9d60-3106f5b1d025 ------=_Part_10948_7643008.1214610776762 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline On Fri, Jun 27, 2008 at 4:41 PM, Dave Eckhardt > wrote: > libvx32/freebsd.c:20:2: warning: #warning "libvx32 and FreeBSD 5 and 6's > libpthread are not compatible." > > I guess the priority of my "upgrade laptop's FreeBSD" thread has > just increased. > > Dave Eckhardt > > FreeBSD 7 has been for me quite good... I pretty much stopped using it around FreeBSD 5, and 7 has made me think that over again. ------=_Part_10948_7643008.1214610776762 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline

On Fri, Jun 27, 2008 at 4:41 PM, Dave Eckhardt <davide+p9@cs.cmu.edu> wrote:
libvx32/freebsd.c:20:2: warning: #warning "libvx32 and FreeBSD 5 and 6's libpthread are not compatible."

I guess the priority of my "upgrade laptop's FreeBSD" thread has
just increased.

Dave Eckhardt

FreeBSD 7 has been for me quite good... I pretty much stopped using it around FreeBSD 5, and 7 has made me think that over again. ------=_Part_10948_7643008.1214610776762-- From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <5d375e920806271723p2e3c88cfvf1e26efa7fc09a13@mail.gmail.com> Date: Sat, 28 Jun 2008 02:23:40 +0200 From: Uriel To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <9486.1214610063@lunacy.ugrad.cs.cmu.edu> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <20080627110538.15AA31E8C35@holo.morphisms.net> <9486.1214610063@lunacy.ugrad.cs.cmu.edu> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca0a13d2-ead3-11e9-9d60-3106f5b1d025 Life is so boring when your OS doesn't break compatibility with existing APIs every other release... but my heart is torn between FreeBSD and OS X; ah I got the solution: whoever breaks backwards compatibility (again) first wins! I'm in a hurry to pick my next OS, but this shouldn't take more than a week or two... uriel On Sat, Jun 28, 2008 at 1:41 AM, Dave Eckhardt wrote: > libvx32/freebsd.c:20:2: warning: #warning "libvx32 and FreeBSD 5 and 6's libpthread are not compatible." > > I guess the priority of my "upgrade laptop's FreeBSD" thread has > just increased. > > Dave Eckhardt > > From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <13426df10806271736v3c634259nc3c78fa10d0b32a2@mail.gmail.com> Date: Fri, 27 Jun 2008 17:36:06 -0700 From: "ron minnich" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <062720082329.407.486577E6000DAB200000019722243323629B0A02D2089B9A019C04040A0DBF9B9D0E9A9B9C040D@att.net> MIME-Version: 1.0 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> <3e1162e60806271159l5ed9768cub20a9c5895e132c4@mail.gmail.com> <13426df10806271439s6e5092f6u188b7ac14b2453e6@mail.gmail.com> <062720082329.407.486577E6000DAB200000019722243323629B0A02D2089B9A019C04040A0DBF9B9D0E9A9B9C040D@att.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca0ff270-ead3-11e9-9d60-3106f5b1d025 On Fri, Jun 27, 2008 at 4:29 PM, Brian L. Stuart wrote: > I haven't tried this yet, but is there any reason you > couldn't put block special files for disk partitions > in the 9vx directory and put the arenas, etc there, > assuming of course all the permissions were set right? I see no reason that should not work. Tonight I'm going to try to move my venti/fossil from lguest universe to vx universe if I get time. ron From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <1d5d51400806272136l412abffana7ffd9ba1c69d9d@mail.gmail.com> Date: Sat, 28 Jun 2008 12:36:01 +0800 From: "Fernan Bolando" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080627110538.15AA31E8C35@holo.morphisms.net> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_17104_23918660.1214627762056" References: <20080627110538.15AA31E8C35@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca295cb0-ead3-11e9-9d60-3106f5b1d025 ------=_Part_17104_23918660.1214627762056 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline On 6/27/08, Russ Cox wrote: > > a quick announcement: > > http://swtch.com/9vx/ > > i'll have time to say more later. > > > russ > > > Wow. This is cool! I can now test my ports locally. It should be possible for two 9vx instance to communicate with each other right? Bryan and Russ thanks a lot fernan -- http://www.fernski.com ------=_Part_17104_23918660.1214627762056 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline
On 6/27/08, Russ Cox <rsc@swtch.com> wrote:
a quick announcement:

        http://swtch.com/9vx/

i'll have time to say more later.


russ




Wow. This is cool! I can now test my ports locally.  It should be possible for two 9vx instance to communicate with each other right?

Bryan and Russ thanks a lot

fernan

--
http://www.fernski.com ------=_Part_17104_23918660.1214627762056-- From mboxrd@z Thu Jan 1 00:00:00 1970 From: "Brian L. Stuart" To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Date: Sat, 28 Jun 2008 04:59:45 +0000 Message-Id: <062820080459.18333.4865C540000ECBD50000479D22230680329B0A02D2089B9A019C04040A0DBF9B9D0E9A9B9C040D@att.net> In-Reply-To: <062720082329.407.486577E6000DAB200000019722243323629B0A02D2089B9A019C04040A0DBF9B9D0E9A9B9C040D@att.net> References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10806270852i5e57e2f6kc0dc756c177119f8@mail.gmail.com> <13426df10806271039m68b04026p9e9d1c84a2f6c16e@mail.gmail.com> <3e1162e60806271159l5ed9768cub20a9c5895e132c4@mail.gmail.com> <13426df10806271439s6e5092f6u188b7ac14b2453e6@mail.gmail.com> <062720082329.407.486577E6000DAB200000019722243323629B0A02D2089B9A019C04040A0DBF9B9D0E9A9B9C040D@att.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca2e432e-ead3-11e9-9d60-3106f5b1d025 > I haven't tried this yet, but is there any reason you > couldn't put block special files for disk partitions > in the 9vx directory and put the arenas, etc there, > assuming of course all the permissions were set right? > I'll probably give it a try later tonight unless someone > yells "Stop! You'll poke out your eye^W partition table." Well, unless I'm missing something either obvious or clever, the answer is no. A Linux special file looks like a zero length regular file to 9vx. I probably should have expected that. I guess I'll sleep on the question of whether to just use regular files or do something like a driver to go with devsd. BLS From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <56bcf448db0216b0bc935cb543658ab4@proxima.alt.za> To: 9fans@9fans.net Date: Sat, 28 Jun 2008 07:03:31 +0200 From: lucio@proxima.alt.za In-Reply-To: MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca33daf0-ead3-11e9-9d60-3106f5b1d025 > i've not had a chance to look through the sources. is a windows port > feasible? I haven't looked at anything at all, but I've also never seen such a happy reception on this list. Please excuse the possible stupidity of this question: is a Plan 9 port feasible? ++L From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <683f45dab9b458ece4510148979aeece@quanstro.net> From: erik quanstrom Date: Sat, 28 Jun 2008 07:25:04 -0400 To: 9fans@9fans.net In-Reply-To: <062820080459.18333.4865C540000ECBD50000479D22230680329B0A02D2089B9A019C04040A0DBF9B9D0E9A9B9C040D@att.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca38a328-ead3-11e9-9d60-3106f5b1d025 > Well, unless I'm missing something either obvious > or clever, the answer is no. A Linux special file > looks like a zero length regular file to 9vx. I > probably should have expected that. the bits from p9p's _p9dir.c which were discussed the other day could be used to solve that problem. i think that would be enough for disk/partfs. - erik From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Sat, 28 Jun 2008 11:23:27 -0400 In-Reply-To: <56bcf448db0216b0bc935cb543658ab4@proxima.alt.za> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080628152138.4217D1E8C35@holo.morphisms.net> Topicbox-Message-UUID: ca3cbc56-ead3-11e9-9d60-3106f5b1d025 Replying to many messages/threads ... ---------- > i've not had a chance to look through the sources. is a windows port > feasible? It should be doable. You need equivalents of mmap, mprotect, munmap, signal handlers, timer signals, and some function to install new segment descriptors. All of these exist on Windows XP. The last may or may not exist anymore on Vista; I have heard conflicting reports. It's doable, but you'd have to be comfortable with writing and debugging very low-level code. It is close to bringing Plan 9 up on a new machine. Easier to debug than real hardware, but that's not saying much. And getting floating point working is typically more difficult than on real hardware, since the hardware has an accurate manual. ---------- > If you call translating the X API to Win32 or C++ .NET feasible, then yes! > I'm struggling to Cocoa-ize it. It seems like a much easier job than with > drawterm. The graphics code should be the least of your problems. That code hasn't been changed much since drawterm, so you should be able to just drop the drawterm version in. > I believe the only folder you need to update is src/9vx/x11. It's seven > files of pure evil. Thanks for the ringing endorsement. > I'm struggling to Cocoa-ize it. It seems like a much easier job than with > drawterm. Instead of starting over, just drop in the drawterm code and adjust until it fits. It's almost exactly the same interface. In fact much of the code is exactly the same as drawterm, there's just this new x86 engine dropped into the mix. I would definitely look there first if I wanted to add something. ---------- > I haven't looked at anything at all, but I've also never seen such a > happy reception on this list. Please excuse the possible stupidity of > this question: is a Plan 9 port feasible? Not with Plan 9 as it stands right now. The virtual memory system is really not set up for page-at-a-time mappings like 9vx needs, and there's no facility to create new segment descriptors, though that would be easier to fix. One also wonders what use it would be. You could just start a new shell and fiddle with its name space instead. ---------- >> Well, unless I'm missing something either obvious >> or clever, the answer is no. A Linux special file >> looks like a zero length regular file to 9vx. I >> probably should have expected that. > > the bits from p9p's _p9dir.c which were discussed the > other day could be used to solve that problem. Added these yesterday afternoon (still have to set up a public repository somewhere.) > I guess I'll sleep on the question of whether to just > use regular files or do something like a driver to > go with devsd. I added devsd and wrote an sd loopback yesterday afternoon. It worked pretty well except that when I ran fdisk, /dev/sd00/data disappeared. I was going to debug that before saying anything. vx32% ls -l /dev/sd* --rw-r----- S 0 rsc rsc 0 Jun 27 15:39 /dev/sdctl vx32% bind '#Z' /n/unix vx32% ls -l /n/unix/dev/sda --rw-rw---- Z 2 root rsc 250059350016 May 17 16:12 /n/unix/dev/sda vx32% echo loop rw /n/unix/dev/sda >/dev/sdctl vx32% ls -l /dev/sd* --rw-r----- S 0 rsc rsc 0 Jun 27 15:39 /dev/sd00/ctl --rw-r----- S 0 rsc rsc 250059350016 Jun 27 15:39 /dev/sd00/data -lrw------- S 0 rsc rsc 0 Jun 27 15:39 /dev/sd00/raw --rw-r----- S 0 rsc rsc 0 Jun 27 15:39 /dev/sdctl vx32% disk/fdisk -p /dev/sd00/data >/dev/sd00/ctl vx32% ls -l /dev/sd* --rw-r----- S 0 rsc rsc 0 Jun 27 15:39 /dev/sd00/ctl --rw-r----- S 0 rsc rsc 243830168064 Jun 27 15:39 /dev/sd00/linux --rw-r----- S 0 rsc rsc 6226504704 Jun 27 15:39 /dev/sd00/linuxswap -lrw------- S 0 rsc rsc 0 Jun 27 15:39 /dev/sd00/raw --rw-r----- S 0 rsc rsc 0 Jun 27 15:39 /dev/sdctl vx32% ---------- > Wow. This is cool! I can now test my ports locally. It should be possible > for two 9vx instance to communicate with each other right? Sure. They all share the host's IP stack. Also, I should add that #Z knows how to open Unix domain sockets, you can mount p9p servers: vx32% bind '#Z' /n/unix vx32% aux/stub -d /mnt/factotum vx32% mount /n/unix/tmp/ns.rsc.:0/factotum /mnt/factotum vx32% ls -l /mnt/factotum -lrw------- M 15 rsc rsc 0 Jun 28 11:11 /mnt/factotum/confirm --r-------- M 15 rsc rsc 0 Jun 28 11:11 /mnt/factotum/conv --rw------- M 15 rsc rsc 0 Jun 28 11:11 /mnt/factotum/ctl -lrw------- M 15 rsc rsc 0 Jun 28 11:11 /mnt/factotum/log -lrw------- M 15 rsc rsc 0 Jun 28 11:11 /mnt/factotum/needkey --r--r--r-- M 15 rsc rsc 0 Jun 28 11:11 /mnt/factotum/proto --rw-rw-rw- M 15 rsc rsc 0 Jun 28 11:11 /mnt/factotum/rpc vx32% (The aux/stub is needed because p9p factotum doesn't present the top-level factotum directory that Plan 9's does, unless you start it with the -x flag. Could make that an attach specifier instead.) ---------- >> libvx32/freebsd.c:20:2: warning: #warning "libvx32 and FreeBSD 5 and 6's libpthread are not compatible." >> >> I guess the priority of my "upgrade laptop's FreeBSD" thread has >> just increased. > > Life is so boring when your OS doesn't break compatibility with > existing APIs every other release... but my heart is torn between > FreeBSD and OS X; ah I got the solution: whoever breaks backwards > compatibility (again) first wins! I'm in a hurry to pick my next OS, FreeBSD is *very* good about backward compatibility, about as good as Plan 9 is. I can still run decade old FreeBSD binaries. The problem here isn't backward compatibility. It's that FreeBSD, like Linux and the others, took a while to figure out that threads really need to be implemented by the kernel, and they didn't get around to that until FreeBSD 7. ---------- My plan is to push out a new release once someone finds and fixes the OS X cpu bug. Anyone? Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <3e1162e60806280832o26ebf14dsec43c5bcecc1d718@mail.gmail.com> Date: Sat, 28 Jun 2008 08:32:04 -0700 From: "David Leimbach" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <5d375e920806271723p2e3c88cfvf1e26efa7fc09a13@mail.gmail.com> MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_12357_9921043.1214667125033" References: <20080627110538.15AA31E8C35@holo.morphisms.net> <9486.1214610063@lunacy.ugrad.cs.cmu.edu> <5d375e920806271723p2e3c88cfvf1e26efa7fc09a13@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca411922-ead3-11e9-9d60-3106f5b1d025 ------=_Part_12357_9921043.1214667125033 Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline So I guess that rules out linux :-) On Fri, Jun 27, 2008 at 5:23 PM, Uriel wrote: > Life is so boring when your OS doesn't break compatibility with > existing APIs every other release... but my heart is torn between > FreeBSD and OS X; ah I got the solution: whoever breaks backwards > compatibility (again) first wins! I'm in a hurry to pick my next OS, > but this shouldn't take more than a week or two... > > uriel > > On Sat, Jun 28, 2008 at 1:41 AM, Dave Eckhardt > > wrote: > > libvx32/freebsd.c:20:2: warning: #warning "libvx32 and FreeBSD 5 and 6's > libpthread are not compatible." > > > > I guess the priority of my "upgrade laptop's FreeBSD" thread has > > just increased. > > > > Dave Eckhardt > > > > > > ------=_Part_12357_9921043.1214667125033 Content-Type: text/html; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Content-Disposition: inline So I guess that rules out linux :-)

On Fri, Jun 27, 2008 at 5:23 PM, Uriel <uriel99@gmail.com> wrote:
Life is so boring when your OS doesn't break compatibility with
existing APIs every other release... but my heart is torn between
FreeBSD and OS X; ah I got the solution: whoever breaks backwards
compatibility (again) first wins! I'm in a hurry to pick my next OS,
but this shouldn't take more than a week or two...

uriel

On Sat, Jun 28, 2008 at 1:41 AM, Dave Eckhardt <davide+p9@cs.cmu.edu> wrote:
> libvx32/freebsd.c:20:2: warning: #warning "libvx32 and FreeBSD 5 and 6's libpthread are not compatible."
>
> I guess the priority of my "upgrade laptop's FreeBSD" thread has
> just increased.
>
> Dave Eckhardt
>
>


------=_Part_12357_9921043.1214667125033-- From mboxrd@z Thu Jan 1 00:00:00 1970 MIME-version: 1.0 Content-transfer-encoding: 7BIT Content-type: text/plain; charset=US-ASCII; format=flowed Message-id: From: Pietro Gagliardi To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> In-reply-to: <56bcf448db0216b0bc935cb543658ab4@proxima.alt.za> Date: Sat, 28 Jun 2008 13:28:41 -0400 References: <56bcf448db0216b0bc935cb543658ab4@proxima.alt.za> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca48d0a4-ead3-11e9-9d60-3106f5b1d025 Yes. It's a single line of code: exec rc -c '{ newns; rio }' On Jun 28, 2008, at 1:03 AM, lucio@proxima.alt.za wrote: >> i've not had a chance to look through the sources. is a windows port >> feasible? > > I haven't looked at anything at all, but I've also never seen such a > happy reception on this list. Please excuse the possible stupidity of > this question: is a Plan 9 port feasible? > > ++L > > From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <123d24e6f76185865dc30ead0ec3ab89@proxima.alt.za> To: 9fans@9fans.net Date: Sat, 28 Jun 2008 19:29:47 +0200 From: lucio@proxima.alt.za In-Reply-To: <20080628152138.4217D1E8C35@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca4c9770-ead3-11e9-9d60-3106f5b1d025 >> I haven't looked at anything at all, but I've also never seen such a >> happy reception on this list. Please excuse the possible stupidity of >> this question: is a Plan 9 port feasible? > > Not with Plan 9 as it stands right now. The virtual memory > system is really not set up for page-at-a-time mappings > like 9vx needs, and there's no facility to create new segment > descriptors, though that would be easier to fix. One also > wonders what use it would be. You could just start a new > shell and fiddle with its name space instead. I'm sure I risk making a total fool of myself here, seeing as I don't know anything about VX, nevermind 9vx. But I am of the opinion that Plan 9 is still preferable as a platform on which to do virtualisation and the ability to run a VX port on Plan 9 may be the trigger for other OSes to follow. And if that is totally off the mark, don't bother reading the rest of my post, just put me out of your misery :-) There are two possible errors in my speculations: firstly that having VX capabilities over Plan 9 isn't sufficient to provide a virtualisation environment for, say Linux (as I say, I'm really shooting in the dark here, feel free to educate me) and secondly that Plan 9's elegance will not have the appeal I would expect. Russ' technical reservations are real enough, but not unsurmountable. ++L From mboxrd@z Thu Jan 1 00:00:00 1970 MIME-version: 1.0 Content-transfer-encoding: 7BIT Content-type: text/plain; charset=US-ASCII; format=flowed; delsp=yes Message-id: From: Pietro Gagliardi To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> In-reply-to: <20080628152138.4217D1E8C35@holo.morphisms.net> Date: Sat, 28 Jun 2008 13:30:44 -0400 References: <20080628152138.4217D1E8C35@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca50c552-ead3-11e9-9d60-3106f5b1d025 On Jun 28, 2008, at 11:23 AM, Russ Cox wrote: > Instead of starting over, just drop in the drawterm code > and adjust until it fits. It's almost exactly the same interface. Interesting. I'll try that and find out how it goes. (I was starting to use Interface Builder and Xcode!) There is one bug, though, in the drawterm code: 1) Copy something in OS X 2) Paste in Plan 9 3) Copy something smaller 4) Paste in Plan 9 Apparently, drawterm doesn't truncate. I'll see why. From mboxrd@z Thu Jan 1 00:00:00 1970 MIME-version: 1.0 Content-transfer-encoding: 7BIT Content-type: text/plain; charset=US-ASCII; format=flowed; delsp=yes Message-id: <4C528114-1624-4C10-A69D-90A5CE2A56A4@mac.com> From: Pietro Gagliardi To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> In-reply-to: Date: Sat, 28 Jun 2008 13:35:00 -0400 References: <56bcf448db0216b0bc935cb543658ab4@proxima.alt.za> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ca55c9ee-ead3-11e9-9d60-3106f5b1d025 scratch that - no newns. (what is it's name?) On Jun 28, 2008, at 1:28 PM, Pietro Gagliardi wrote: > Yes. It's a single line of code: > > exec rc -c '{ newns; rio }' > > On Jun 28, 2008, at 1:03 AM, lucio@proxima.alt.za wrote: > >>> i've not had a chance to look through the sources. is a windows >>> port >>> feasible? >> >> I haven't looked at anything at all, but I've also never seen such a >> happy reception on this list. Please excuse the possible stupidity >> of >> this question: is a Plan 9 port feasible? >> >> ++L >> >> > > From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <140e7ec30806300832h11439366p14a39432c427680c@mail.gmail.com> Date: Mon, 30 Jun 2008 23:32:01 +0800 From: sqweek To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <80c6273283830706af6c8aaffe5077eb@quanstro.net> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <12611fc761e105e8b2711f919c032ff3@csplan9.rit.edu> <80c6273283830706af6c8aaffe5077eb@quanstro.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: cd927242-ead3-11e9-9d60-3106f5b1d025 On Fri, Jun 27, 2008 at 10:12 PM, erik quanstrom wrote: > there's not access to the network device per ce, but the network works > fine for me. this is what i needed to do to connect to plan 9 > networks > > 1. edit /lib/ndb/auth and /lib/ndb/local as appropriate. > 2. rm /net/cs; ndb/cs > 3. auth/factotum > 4. cpu -h $host Same recipe works here. But I've no idea why the rm /net/cs is necessary - can anyone put me out of my misery? -sqweek From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Mon, 30 Jun 2008 12:09:10 -0400 In-Reply-To: <140e7ec30806300832h11439366p14a39432c427680c@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080630160650.D5AD31E8C22@holo.morphisms.net> Topicbox-Message-UUID: cdeb3030-ead3-11e9-9d60-3106f5b1d025 > Same recipe works here. But I've no idea why the rm /net/cs is > necessary - can anyone put me out of my misery? There are a bunch of rough edges that need to be fixed. This is one of them. 9vx provides a #I/cs so that you can do things like hget without starting cs. But it can't translate auth domains via /lib/ndb, which factotum needs it to do. So you have to start the more full-featured ndb/cs, but that mounts itself on /net using MAFTER (a bug, if you ask me). Because I knew I couldn't get a fix to ndb/cs into the distribution in time, I made the #I/cs file removable. Originally, the reason for providing #I/cs was to provide access to host DNS lookups, just like it does in drawterm. Now that there is a separate #I/dns (that ndb/cs will use), it might be that the right thing to do is just toss away #I/cs so that termrc will start a real one. Another rough edge, if anyone wants a challenge, is that gs goes into an I/O-free loop after reading the first 4k of /sys/lib/ghostscript/gs_init.ps. (I deleted gs from the 9vx tar file to save space, so you'll have to run against a distribution tree instead.) Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <14ec7b180806301000w652e5bifac6c730ce2762b0@mail.gmail.com> Date: Mon, 30 Jun 2008 11:00:40 -0600 From: "andrey mirtchovski" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080630160650.D5AD31E8C22@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <140e7ec30806300832h11439366p14a39432c427680c@mail.gmail.com> <20080630160650.D5AD31E8C22@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: cdf6eb64-ead3-11e9-9d60-3106f5b1d025 now that you've explained the cs issue things are much clearer. i can confirm that I have successfully booted a 9vx terminal off a remote plan9 server using a small modification to factotum. the original boot process failed with: password: ! authentication failed (auth_proxy rpc write: bootes: Connection refused), trying mount anyways boot: mount /: fossil authCheck: auth protocol not finished 9vx panic: boot process died: unknown and the change simply sidesteps factotum using cs to figure out who/what to dial, instead just using IP addresses. here's the hack: 9grid% yesterday -d util.c diff /n/dump/2008/0630/sys/src/cmd/auth/factotum/util.c /sys/src/cmd/auth/factotum/util.c 33c33 < return authdial(net, authdom); --- > ;//return authdial(net, authdom); 9grid% now compile 8.factotum and copy it as 9vx/src/9vx/factotum.9 and recompile 9vx. unfortunately with a terminal booted thusly i no longer have /mnt/term :) From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <14ec7b180806301007k3cdacee0ieb2d3b0fd6916abb@mail.gmail.com> Date: Mon, 30 Jun 2008 11:07:25 -0600 From: "andrey mirtchovski" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <14ec7b180806301000w652e5bifac6c730ce2762b0@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <140e7ec30806300832h11439366p14a39432c427680c@mail.gmail.com> <20080630160650.D5AD31E8C22@holo.morphisms.net> <14ec7b180806301000w652e5bifac6c730ce2762b0@mail.gmail.com> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: ce2ab7b4-ead3-11e9-9d60-3106f5b1d025 > now compile 8.factotum and copy it as 9vx/src/9vx/factotum.9 and recompile 9vx. err, make that vx32/src/9vx/factotum.9. i'm compiling against the latest mercurial, but there's not reason why it shouldn't just work with .11 and .10 From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Mon, 30 Jun 2008 14:02:03 -0400 In-Reply-To: <14ec7b180806301000w652e5bifac6c730ce2762b0@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080630175944.17C9D1E8C1C@holo.morphisms.net> Topicbox-Message-UUID: cef1c566-ead3-11e9-9d60-3106f5b1d025 > 9grid% yesterday -d util.c > diff /n/dump/2008/0630/sys/src/cmd/auth/factotum/util.c > /sys/src/cmd/auth/factotum/util.c > 33c33 > < return authdial(net, authdom); > --- >> ;//return authdial(net, authdom); > 9grid% Does it work to set csremoved=1 in src/9vx/devip.c instead? > unfortunately with a terminal booted thusly i no longer have /mnt/term :) bind '#Z' /mnt/term Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <14ec7b180806301134u46fe13e4n3eea27a466c971b1@mail.gmail.com> Date: Mon, 30 Jun 2008 12:34:03 -0600 From: "andrey mirtchovski" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> In-Reply-To: <20080630175944.17C9D1E8C1C@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <14ec7b180806301000w652e5bifac6c730ce2762b0@mail.gmail.com> <20080630175944.17C9D1E8C1C@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: cf3bd674-ead3-11e9-9d60-3106f5b1d025 > Does it work to set csremoved=1 in src/9vx/devip.c instead? I can confirm that this works, with the benefit of using secstore instead of prompting for my password. From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Mon, 30 Jun 2008 14:44:41 -0400 In-Reply-To: <14ec7b180806301134u46fe13e4n3eea27a466c971b1@mail.gmail.com> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080630184222.ACB421E8C1C@holo.morphisms.net> Topicbox-Message-UUID: cf42adb4-ead3-11e9-9d60-3106f5b1d025 >> Does it work to set csremoved=1 in src/9vx/devip.c instead? > > I can confirm that this works, with the benefit of using secstore > instead of prompting for my password. Okay, done. Thanks. Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Date: Mon, 30 Jun 2008 19:29:25 -0700 From: Anthony Martin To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Message-ID: <20080701022925.GA19265@dinah> References: <56bcf448db0216b0bc935cb543658ab4@proxima.alt.za> <20080628152138.4217D1E8C35@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <20080628152138.4217D1E8C35@holo.morphisms.net> Subject: Re: [9fans] 9vx Topicbox-Message-UUID: d1506eac-ead3-11e9-9d60-3106f5b1d025 > I added devsd and wrote an sd loopback yesterday afternoon. > It worked pretty well except that when I ran fdisk, > /dev/sd00/data disappeared. I was going to debug that > before saying anything. Here's the fix for the fdisk problem: /sys/src/cmd/disk/prep/edit.c:503,508 - edit.c:503,509 */ for(i=0; inctlpart; i++) { p = edit->ctlpart[i]; + if(strncmp(p->ctlname, "data", 5) != 0) if(p->changed) if(fprint(ctlfd, "delpart %s\n", p->ctlname)<0) { fprint(2, "delpart failed: %s: %r\n", p->ctlname); Anthony From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <5323b750f50b30ff0911d940775e072d@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Tue, 1 Jul 2008 05:09:06 -0400 In-Reply-To: <20080701022925.GA19265@dinah> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: d1cb15a8-ead3-11e9-9d60-3106f5b1d025 >> I added devsd and wrote an sd loopback yesterday afternoon. >> It worked pretty well except that when I ran fdisk, >> /dev/sd00/data disappeared. I was going to debug that >> before saying anything. > > Here's the fix for the fdisk problem: > > /sys/src/cmd/disk/prep/edit.c:503,508 - edit.c:503,509 > */ > for(i=0; inctlpart; i++) { > p = edit->ctlpart[i]; > + if(strncmp(p->ctlname, "data", 5) != 0) > if(p->changed) > if(fprint(ctlfd, "delpart %s\n", p->ctlname)<0) { > fprint(2, "delpart failed: %s: %r\n", p->ctlname); i don't think this is the right solution. as geoff pointed out, fdisk shouldn't be deleteing the parent partition or any partitions that lie outside its parent partition. obviously prep has a similar problem. - erik From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Tue, 1 Jul 2008 08:10:22 -0400 In-Reply-To: <20080701022925.GA19265@dinah> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080701120805.22ECF1E8C22@holo.morphisms.net> Topicbox-Message-UUID: d1ff037c-ead3-11e9-9d60-3106f5b1d025 > Here's the fix for the fdisk problem: > > /sys/src/cmd/disk/prep/edit.c:503,508 - edit.c:503,509 > */ > for(i=0; inctlpart; i++) { > p = edit->ctlpart[i]; > + if(strncmp(p->ctlname, "data", 5) != 0) > if(p->changed) > if(fprint(ctlfd, "delpart %s\n", p->ctlname)<0) { > fprint(2, "delpart failed: %s: %r\n", p->ctlname); That would work, but one wonders why the normal kernel doesn't have this problem. Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <66b9839fdb955f8f969063ccff722c4c@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Tue, 1 Jul 2008 09:25:12 -0400 In-Reply-To: <20080701120805.22ECF1E8C22@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: d2bcdafa-ead3-11e9-9d60-3106f5b1d025 >> Here's the fix for the fdisk problem: >> >> /sys/src/cmd/disk/prep/edit.c:503,508 - edit.c:503,509 >> */ >> for(i=0; inctlpart; i++) { >> p = edit->ctlpart[i]; >> + if(strncmp(p->ctlname, "data", 5) != 0) >> if(p->changed) >> if(fprint(ctlfd, "delpart %s\n", p->ctlname)<0) { >> fprint(2, "delpart failed: %s: %r\n", p->ctlname); on second read, with this approach, i would think that strcmp() not strncmp should be used. > > That would work, but one wonders why > the normal kernel doesn't have this problem. this must be a quirk of the interaction between devsd and fdisk. by hand data does disappear: ; lc 9fat ctl data nvram plan9 raw ; for(i in 9fat data nvram plan9 data)echo delpart $i>ctl ; lc ctl raw by the way, be very careful with this before applying this patch: ; diff -c /sys/src/9/port/devsd.c /n/dump/2008/0701/sys/src/9/port/devsd.c /sys/src/9/port/devsd.c:147,153 - /n/dump/2008/0701/sys/src/9/port/devsd.c:147,152 */ pp = unit->part; for(i = 0; i < unit->npart; i++){ - if(pp->name) if(strcmp(name, pp->name) == 0) break; pp++; this is required because npart is set to the number of partitions allocated. the names never-set partitions might be 0. otherwise "delpart missingpart>/dev/sdXX/ctl" will be a noisy and somewhat gratituous synonym for "echo reboot>/dev/reboot". - erik From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Tue, 1 Jul 2008 10:40:47 -0400 In-Reply-To: <66b9839fdb955f8f969063ccff722c4c@quanstro.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080701143831.E53B11E8C6B@holo.morphisms.net> Topicbox-Message-UUID: d31daf4c-ead3-11e9-9d60-3106f5b1d025 > this must be a quirk of the interaction between > devsd and fdisk. by hand data does disappear: > > ; lc > 9fat ctl data nvram plan9 raw > ; for(i in 9fat data nvram plan9 data)echo delpart $i>ctl > ; lc > ctl raw You are allowed to delete the data partition. The problem is that fdisk should not be trying to. Since it doesn't do that on native Plan 9, there must be some aspect of devsd that is not behaving the same way under 9vx that it does under Plan 9. The bug is in devsd, though you'll probably have to add prints to fdisk to find it. Plan 9: glenda# disk/fdisk -p /dev/sdC0/data part linux 63 58589055 part plan9 58589055 241248105 glenda# 9vx: % bind '#Z' /n/unix % echo loop rw /n/unix/dev/sda >/dev/sdctl % disk/fdisk -p /dev/sd00/data delpart data part linux 63 476230860 part linuxswap 476230923 488392065 % That's running on a different disk but the same fdisk binary (the one from sources as of today, dated May 10). Russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <0198b2f317e3cdff426f7f306c9f4dae@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Tue, 1 Jul 2008 13:23:29 -0400 In-Reply-To: <20080701143831.E53B11E8C6B@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: d3ccbf28-ead3-11e9-9d60-3106f5b1d025 > The bug is in devsd, though you'll probably have to > add prints to fdisk to find it. > yup. 9vx creates ctl files without a "geometry line". libdisk/disk.c:/^opensd demands it. also, it would be nice if 9vx devsd created an entry in sdctl for each loopback controller. i apologize for not sending a patch. i haven't yet gotten the vx32 compilers working on my machine. i'm sure this is operator error. - erik From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx From: "Russ Cox" Date: Tue, 1 Jul 2008 13:32:05 -0400 In-Reply-To: <0198b2f317e3cdff426f7f306c9f4dae@quanstro.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080701172950.682A71E8C51@holo.morphisms.net> Topicbox-Message-UUID: d3f94322-ead3-11e9-9d60-3106f5b1d025 > yup. 9vx creates ctl files without a "geometry line". > libdisk/disk.c:/^opensd demands it. thanks. > also, it would be nice if 9vx devsd created an entry > in sdctl for each loopback controller. i intended it to, though perhaps i messed that up. > i apologize for not sending a patch. i haven't yet > gotten the vx32 compilers working on my machine. > i'm sure this is operator error. you don't need them to build 9vx. just "make 9vx/9vx" instead of make. looking forward to a patch. ;-) russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <4c0ee2c39d91816282603bb65551ef72@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Tue, 1 Jul 2008 14:50:10 -0400 In-Reply-To: <20080701172950.682A71E8C51@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: d416c05a-ead3-11e9-9d60-3106f5b1d025 rc bug. it appears something is going wrong with rc's local assignments. ifs has the usual value. ; font=/lib/font/bit/cyberbit/mod*.font rio rio: can't access /lib/font/bit/cyberbit/mod*.font: bad character in file name: '/lib/font/bit/cyberbit/mod*.font' ; unicode  0001 ; echo /lib/font/bit/cyberbit/mod*.font /lib/font/bit/cyberbit/mod14.font ; x=/lib/font/bit/cyberbit/mod*.font ; whatis x x=/lib/font/bit/cyberbit/mod14.font - erik From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: rc bug From: "Russ Cox" Date: Tue, 1 Jul 2008 15:11:19 -0400 In-Reply-To: <4c0ee2c39d91816282603bb65551ef72@quanstro.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080701190905.B88951E8C51@holo.morphisms.net> Topicbox-Message-UUID: d41ee4ce-ead3-11e9-9d60-3106f5b1d025 > rc bug. please put non-9vx bugs in their own threads. thanks. > it appears something is going wrong > with rc's local assignments. ifs has the usual > value. > > ; font=/lib/font/bit/cyberbit/mod*.font rio > rio: can't access /lib/font/bit/cyberbit/mod*.font: bad character in file name: '/lib/font/bit/cyberbit/mod*.font' > ; unicode  > 0001 > ; echo /lib/font/bit/cyberbit/mod*.font > /lib/font/bit/cyberbit/mod14.font > ; x=/lib/font/bit/cyberbit/mod*.font > ; whatis x > x=/lib/font/bit/cyberbit/mod14.font % diff -c /n/sources/plan9/sys/src/cmd/rc/exec.c . /n/sources/plan9/sys/src/cmd/rc/exec.c:751,759 - ./exec.c:751,761 } deglob(runq->argv->words->word); runq->local = newvar(strdup(runq->argv->words->word), runq->local); - runq->local->val = copywords(runq->argv->next->words, (word *)0); - runq->local->changed = 1; poplist(); + globlist(); + runq->local->val = runq->argv->words; + runq->local->changed = 1; + runq->argv->words = 0; poplist(); } % russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <64b46ee8821018a7e55ab8ff8fbef852@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Tue, 1 Jul 2008 17:13:57 -0400 In-Reply-To: <20080701190905.B88951E8C51@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: 8bit Subject: Re: [9fans] rc bug Topicbox-Message-UUID: d505369a-ead3-11e9-9d60-3106f5b1d025 >> rc bug. > > please put non-9vx bugs in their own threads. thanks. i thought it was. sorry. in any event, 9vx ps has the quirk that it thinks every command that hasn't set its args has 1 argument, argv[0] consisting of the entire argument list. unless my kernel is somehow out-of-date, this is 9vx specific. ☺ - erik From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] 9vx ps bug From: "Russ Cox" Date: Tue, 1 Jul 2008 17:28:33 -0400 In-Reply-To: <64b46ee8821018a7e55ab8ff8fbef852@quanstro.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080701212618.7B7021E8C51@holo.morphisms.net> Topicbox-Message-UUID: d50957fc-ead3-11e9-9d60-3106f5b1d025 > in any event, 9vx ps has the quirk that it thinks every command > that hasn't set its args has 1 argument, argv[0] consisting of > the entire argument list. > > unless my kernel is somehow out-of-date, this is 9vx specific. yes it is. i did not understand the format of p->args when i rewrote sysexec. fixed in hg. russ From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: To: 9fans@9fans.net From: "Fazlul Shahriar" Date: Tue, 1 Jul 2008 17:59:51 -0400 In-Reply-To: <20080701190905.B88951E8C51@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] rc bug Topicbox-Message-UUID: d527e19a-ead3-11e9-9d60-3106f5b1d025 I saw something similar before, but unfortunately, the patch below doesn't fix it. cpu% fn 'file?' { test -f $* } cpu% 'file?' /LICENSE cpu% echo $status cpu% 'file?' /foo cpu% echo $status test 145387: false cpu% rc cpu% 'file?' /LICENSE rc: can't open /env/fn#file?: bad character in file name: '/env/fn#file?' file?: '/bin/file?' file does not exist cpu% 'file?' /LICENSE file?: '/bin/file?' file does not exist cpu% unicode  0001 cpu% >> it appears something is going wrong >> with rc's local assignments. ifs has the usual >> value. >> >> ; font=/lib/font/bit/cyberbit/mod*.font rio >> rio: can't access /lib/font/bit/cyberbit/mod*.font: bad character in file name: '/lib/font/bit/cyberbit/mod*.font' >> ; unicode  >> 0001 >> ; echo /lib/font/bit/cyberbit/mod*.font >> /lib/font/bit/cyberbit/mod14.font >> ; x=/lib/font/bit/cyberbit/mod*.font >> ; whatis x >> x=/lib/font/bit/cyberbit/mod14.font > > % diff -c /n/sources/plan9/sys/src/cmd/rc/exec.c . > /n/sources/plan9/sys/src/cmd/rc/exec.c:751,759 - ./exec.c:751,761 > } > deglob(runq->argv->words->word); > runq->local = newvar(strdup(runq->argv->words->word), runq->local); > - runq->local->val = copywords(runq->argv->next->words, (word *)0); > - runq->local->changed = 1; > poplist(); > + globlist(); > + runq->local->val = runq->argv->words; > + runq->local->changed = 1; > + runq->argv->words = 0; > poplist(); > } > > % From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] rc bug From: "Russ Cox" Date: Tue, 1 Jul 2008 19:11:11 -0400 In-Reply-To: MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080701230856.C400F1E8C1C@holo.morphisms.net> Topicbox-Message-UUID: d5413db6-ead3-11e9-9d60-3106f5b1d025 > I saw something similar before, but unfortunately, the patch below > doesn't fix it. I submitted a patch. diff ./io.c /n/sources/plan9/sys/src/cmd/rc/io.c 94c94 < for(t = s;*t;t++) if(*t >= 0 && needsrcquote(*t)) break; --- > for(t = s;*t;t++) if(!wordchr(*t)) break; diff ./plan9.c /n/sources/plan9/sys/src/cmd/rc/plan9.c 278c278 < pfmt(fd, "fn %q %s\n", v->name, v->fn[v->pc-1].s); --- > pfmt(fd, "fn %s %s\n", v->name, v->fn[v->pc-1].s); From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <59ce42e3751664630438d1c58da096b7@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Tue, 1 Jul 2008 19:12:07 -0400 In-Reply-To: <20080701230856.C400F1E8C1C@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] rc bug Topicbox-Message-UUID: d548679e-ead3-11e9-9d60-3106f5b1d025 > I submitted a patch. > > diff ./io.c /n/sources/plan9/sys/src/cmd/rc/io.c > 94c94 > < for(t = s;*t;t++) if(*t >= 0 && needsrcquote(*t)) break; > --- >> for(t = s;*t;t++) if(!wordchr(*t)) break; > diff ./plan9.c /n/sources/plan9/sys/src/cmd/rc/plan9.c > 278c278 > < pfmt(fd, "fn %q %s\n", v->name, v->fn[v->pc-1].s); > --- >> pfmt(fd, "fn %s %s\n", v->name, v->fn[v->pc-1].s); i don't think that fixes it. try this test on plan 9 fn 'test?' {echo} lc /env - erik From mboxrd@z Thu Jan 1 00:00:00 1970 To: 9fans@9fans.net Subject: Re: [9fans] rc bug From: "Russ Cox" Date: Tue, 1 Jul 2008 19:31:51 -0400 In-Reply-To: <59ce42e3751664630438d1c58da096b7@quanstro.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Message-Id: <20080701232936.AA6AB1E8C35@holo.morphisms.net> Topicbox-Message-UUID: d54c977e-ead3-11e9-9d60-3106f5b1d025 > i don't think that fixes it. try this test on plan 9 > > fn 'test?' {echo} > lc /env it does, unless you build an 8.out and test it without installing it as /386/bin/rc. when you invoked lc, a shell script, that ran the buggy /386/bin/rc, which polluted the environment. in fact you have to run lc twice to cause the problem: the first rc reads the fn out of the environment and writes it back incorrectly, and the second one then gets confused. vx32% 8.out broken! rfork e broken! fn 'test?' {echo} broken! cat /env/'fn#test?' fn 'test?' {echo} broken! /n/sources/plan9/386/bin/rc -c exit broken! cat /env/'fn#test?' fn test? {echo} broken! /n/sources/plan9/386/bin/rc -c exit rc: can't open /env/fn#test?: bad character in file name: '/env/fn#test?' broken! notice the lack of quotes around test? after buggy rc runs. From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <2ae4f5ca43624f6166f716bdf83e72e9@quanstro.net> To: 9fans@9fans.net From: erik quanstrom Date: Tue, 1 Jul 2008 19:38:58 -0400 In-Reply-To: <20080701232936.AA6AB1E8C35@holo.morphisms.net> MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: Re: [9fans] rc bug Topicbox-Message-UUID: d5509c70-ead3-11e9-9d60-3106f5b1d025 - 9fans. >> i don't think that fixes it. try this test on plan 9 >> >> fn 'test?' {echo} >> lc /env > > it does, unless you build an 8.out and test it > without installing it as /386/bin/rc. > when you invoked lc, a shell script, that ran the buggy > /386/bin/rc, which polluted the environment. > in fact you have to run lc twice to cause the problem: > the first rc reads the fn out of the environment and > writes it back incorrectly, and the second one then > gets confused. pfft. i'm feeling so smart today! doesn't a similar change need to be made in win32.c and simple.c? also, does Xfn need to call deglob() on each function name? - erik From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: <74b28af3a790bf9d7820fdfddd274328@quanstro.net> From: erik quanstrom Date: Sun, 21 Dec 2008 14:19:34 -0500 To: 9fans@9fans.net MIME-Version: 1.0 Content-Type: text/plain; charset="US-ASCII" Content-Transfer-Encoding: 7bit Subject: [9fans] 9vx Topicbox-Message-UUID: 6b1f7b72-ead4-11e9-9d60-3106f5b1d025 suppose i have a typical kernel complaint giving a address of a lock or some such. what's the easiest way to figure out what's at that address? the equivalent of src($address) or just $address in acid with the normal kernel. - erik From mboxrd@z Thu Jan 1 00:00:00 1970 Message-ID: Date: Mon, 22 Dec 2008 10:52:07 -0800 From: "Russ Cox" To: "Fans of the OS Plan 9 from Bell Labs" <9fans@9fans.net> Subject: Re: [9fans] 9vx In-Reply-To: <74b28af3a790bf9d7820fdfddd274328@quanstro.net> MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Content-Disposition: inline References: <74b28af3a790bf9d7820fdfddd274328@quanstro.net> Topicbox-Message-UUID: 6cbe604c-ead4-11e9-9d60-3106f5b1d025 run gdb on the 9vx binary and type list *0x80123123 russ From mboxrd@z Thu Jan 1 00:00:00 1970 MIME-Version: 1.0 In-Reply-To: <20080627151526.76D701E8C2B@holo.morphisms.net> References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> Date: Mon, 27 Apr 2009 22:10:31 -0700 Message-ID: <13426df10904272210v5e6eb273n185899b4365ee60c@mail.gmail.com> From: ron minnich To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Content-Type: text/plain; charset=ISO-8859-1 Content-Transfer-Encoding: 7bit Subject: Re: [9fans] 9vx Topicbox-Message-UUID: f3c7b57a-ead4-11e9-9d60-3106f5b1d025 On Fri, Jun 27, 2008 at 8:17 AM, Russ Cox wrote: > if you make clean > and then edit the top-level src/Makefrag file to add -m32 > to the HOST_CFLAGS and then make 9vx/9vx > you are likely to get a working binary. I'm just trying this now. I was missing stubs-32.h on FC9. I had to do this: sudo yum install compat-gcc-34 compat-gcc-34-c++ It's a very important file; it has stuff like this in it :-) #ifdef _LIBC #error Applications may not define the macro _LIBC #endif #define __stub___kernel_cosl #define __stub___kernel_sinl #define __stub___kernel_tanl #define __stub_chflags #define __stub_fattach #define __stub_fchflags #define __stub_fdetach #define __stub_gtty #define __stub_lchmod #define __stub_revoke #define __stub_setlogin #define __stub_sigreturn #define __stub_sstk #define __stub_stty Pretty! I also had to do this: diff -r a18e9872164b src/9vx/Makefrag --- a/src/9vx/Makefrag Wed Dec 10 03:29:15 2008 -0800 +++ b/src/9vx/Makefrag Mon Apr 27 22:02:37 2009 -0700 @@ -124,7 +124,8 @@ x11-kernel.o \ x11-keysym2rune.o \ ) -PLAN9_x11_LIBS = -L/usr/X11R6/lib -L/usr/local/lib -lX11 +#PLAN9_x11_LIBS = -L/usr/X11R6/lib -L/usr/local/lib -L/usr/lib -lX11 +PLAN9_x11_LIBS = /usr/lib/libX11.so.6 PLAN9_osx_OBJS =\ $(addprefix 9vx/osx/, \ @@ -148,7 +149,7 @@ libvx32/libvx32.a \ 9vx/9vx: $(PLAN9_DEPS) - $(HOST_CC) -o $@ $(PLAN9_DEPS) $(PLAN9_GUI_LIBS) -lpthread + $(HOST_CC) $(HOST_LDFLAGS) -o $@ $(PLAN9_DEPS) $(PLAN9_GUI_LIBS) -lpthread 9vx/a/%.o: 9vx/a/%.c $(HOST_CC) $(HOST_CFLAGS) -I. -I9vx -I9vx/a -Wall -Wno-missing-braces -c -o $@ $< diff -r a18e9872164b src/Makefrag --- a/src/Makefrag Wed Dec 10 03:29:15 2008 -0800 +++ b/src/Makefrag Mon Apr 27 22:02:37 2009 -0700 @@ -1,9 +1,9 @@ # Main top-level makefile fragment for the vx32 virtual machine. # Compiler flags common to both host and VX32 environment files. -COMMON_CFLAGS = -g -O3 -MD -std=gnu99 -I. $(CFLAGS) +COMMON_CFLAGS = -g -O3 -MD -std=gnu99 -I. $(CFLAGS) -m32 #COMMON_CFLAGS = -g -MD -std=gnu99 -I. $(CFLAGS) -COMMON_LDFLAGS = -g -L. $(LDFLAGS) +COMMON_LDFLAGS = -g -L. $(LDFLAGS) -m32 # Host environment compiler options HOST_CC := $(CC) Comments: 1. No, it can't find -lX11 even with a little hand-holding -L/usr/lib to help it. Don't know, don't care... 2. It really seems to need HOST_LDFLAGS to work correctly on the 9vx/9vx link step. 3. It didn't work well for me unless I put -m32 on the COMMON_CFLAGS 4. I think what I'm doing with LDFLAGS is wrong wrong wrong And, well, it builds. But it dies. 9vx panic: user fault: signo=11 addr=0 [useraddr=28054000] read=1 eip=80c222a esp=d724cd5c aborting, to dump core. which is: 0x080c2228 : mov %eax,%es 0x080c222a : mov %eax,%ss which makes sense I guess. Anyway, I figure I'll go back and look some more. Probably reset my changes first. ron From mboxrd@z Thu Jan 1 00:00:00 1970 MIME-Version: 1.0 In-Reply-To: <13426df10904272210v5e6eb273n185899b4365ee60c@mail.gmail.com> References: <13426df10806270757h3c364b22wb3bb80312336316d@mail.gmail.com> <20080627151526.76D701E8C2B@holo.morphisms.net> <13426df10904272210v5e6eb273n185899b4365ee60c@mail.gmail.com> Date: Thu, 30 Apr 2009 07:12:19 -0700 Message-ID: Subject: Re: [9fans] 9vx From: Russ Cox To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: 7bit Topicbox-Message-UUID: f4852fb0-ead4-11e9-9d60-3106f5b1d025 the current 9vx tree builds and runs fine using ubuntu on x86-64: c2=; cat /etc/lsb-release DISTRIB_ID=Ubuntu DISTRIB_RELEASE=8.10 DISTRIB_CODENAME=intrepid DISTRIB_DESCRIPTION="Ubuntu 8.10" c2=; uname -a Linux c2 2.6.27-9-generic #1 SMP Thu Nov 20 22:15:32 UTC 2008 x86_64 GNU/Linux c2=; the tree has been broken for a few months. i removed -fno-inline from the gcc command line but apparently that was making gcc work! if you have a partially built tree, you need to make clean after pulling the updates. russ From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_SIGNED,DKIM_VALID, HTML_MESSAGE,MAILING_LIST_MULTI,RCVD_IN_DNSWL_NONE, T_SCC_BODY_TEXT_LINE autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 1707 invoked from network); 25 Jun 2023 05:53:50 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 25 Jun 2023 05:53:50 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 4C59438215 for ; Sun, 25 Jun 2023 01:53:47 -0400 (EDT) (envelope-from bounce.mM8261c3c4a52e717756b68e39.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 4991A1EB3082; Sun, 25 Jun 2023 01:53:47 -0400 (EDT) ARC-Authentication-Results: i=3; topicbox.com; arc=pass (as.1.microsoft.com=pass, ams.1.microsoft.com=pass) smtp.remote-ip=40.107.94.130; dkim=pass (2048-bit rsa key sha256) header.d=huntsmansnet.onmicrosoft.com header.i=@huntsmansnet.onmicrosoft.com header.b=XUULDJJg header.a=rsa-sha256 header.s=selector1-huntsmansnet-onmicrosoft-com x-bits=2048; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=huntsmans.net; spf=pass smtp.mailfrom=ben@huntsmans.net smtp.helo=NAM10-MW2-obe.outbound.protection.outlook.com; x-internal-arc=fail (as.2.topicbox.com=pass, ams.2.topicbox.com=fail (message has been altered), as.1.microsoft.com=pass, ams.1.microsoft.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=3; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:to:date:message-id:content-type :mime-version:list-help:list-id:list-post:list-subscribe :reply-to:subject:content-transfer-encoding:list-unsubscribe; s= sysmsg-1; t=1687672427; bh=8Rvae8ma+k8z2pwVdcOnBsTqnTdCMRbFxVXDW lHD+W0=; b=AuK88WeZW013MQkLwKKluzyVG5UgJXAytWKfCiJefQqX4rnlVmJR1 jphzf43n4b+IjDXySLejCdOBSOb+nhYGiyolz83QCC3wOP4SnwHK1CR/HPdoOWAG rxjhpfnfBPouH7mueeyoPsvfNNVFB1aS26947ILOXlrCDO/vzhaoW0= ARC-Seal: i=3; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1687672427; b=sf4b5A4ItI8TL6t4IftLM/2+aEnmzkyV2k2cBCOl8tpjbkx4GC LWAy0Ye7qFadB90SvmokDcdJv2mUHSwKDJ47BTCdh2EmP6ebsakSDePG/fKNn3pd 7DUdJW3kx3aKC3sTIGqRMUbOPmhmmCHzA4qOWKjy30xFMgf93YnHoLqbs= Authentication-Results: topicbox.com; arc=pass (as.1.microsoft.com=pass, ams.1.microsoft.com=pass) smtp.remote-ip=40.107.94.130; dkim=pass (2048-bit rsa key sha256) header.d=huntsmansnet.onmicrosoft.com header.i=@huntsmansnet.onmicrosoft.com header.b=XUULDJJg header.a=rsa-sha256 header.s=selector1-huntsmansnet-onmicrosoft-com x-bits=2048; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=huntsmans.net; spf=pass smtp.mailfrom=ben@huntsmans.net smtp.helo=NAM10-MW2-obe.outbound.protection.outlook.com; x-internal-arc=fail (as.2.topicbox.com=pass, ams.2.topicbox.com=fail (message has been altered), as.1.microsoft.com=pass, ams.1.microsoft.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=pass (as.1.microsoft.com=pass, ams.1.microsoft.com=pass) smtp.remote-ip=40.107.94.130; bimi=skipped (DMARC did not pass); dkim=pass (2048-bit rsa key sha256) header.d=huntsmansnet.onmicrosoft.com header.i=@huntsmansnet.onmicrosoft.com header.b=XUULDJJg header.a=rsa-sha256 header.s=selector1-huntsmansnet-onmicrosoft-com x-bits=2048; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=huntsmans.net; iprev=pass smtp.remote-ip=40.107.94.130 (mail-mw2nam10on2130.outbound.protection.outlook.com); spf=pass smtp.mailfrom=ben@huntsmans.net smtp.helo=NAM10-MW2-obe.outbound.protection.outlook.com; x-aligned-from=pass (Address match); x-me-sender=none; x-ptr=fail smtp.helo=NAM10-MW2-obe.outbound.protection.outlook.com policy.ptr=mail-mw2nam10on2130.outbound.protection.outlook.com; x-return-mx=pass header.domain=huntsmans.net policy.is_org=yes (MX Records found: huntsmans-net.mail.protection.outlook.com); x-return-mx=pass smtp.domain=huntsmans.net policy.is_org=yes (MX Records found: huntsmans-net.mail.protection.outlook.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h=from:to :date:message-id:content-type:mime-version:list-help:list-id :list-post:list-subscribe:reply-to:subject :content-transfer-encoding:list-unsubscribe; s=dkim-1; t= 1687672427; x=1687758827; bh=1Phkt7+uuf943G82HPtxA3HS2ZjY7pg7SQ1 HDMItA1k=; b=U3WVldNpv+gN71tOyUcGhShRmWqHRy+KfiJ4CfpJFaPcegC9sqY hqDagMG80xdO0x15f20ojhmgzY6czH2qSshfs22c+Am+rMxbwtNwyTZjUmFoWoOg 6sDtKqj2nZcieGpdbJ20Ikhzkwjr0naocAwugG9oXRgTBRXaKs9p704g= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 3BCBA1DFE45B for <9fans@9fans.net>; Sun, 25 Jun 2023 01:53:36 -0400 (EDT) (envelope-from ben@huntsmans.net) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 6641D0E5430; Sun, 25 Jun 2023 01:53:36 -0400 ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=arcseal; t= 1687672416; b=FAFKIjeZGb4qapYNn/z3sWFXwQ+EHrXqNoHeC42JALBlNidjgE nQWu/otaKbUSqcjE5mI37d+tjvAIgSn0B/7r6BJBktU0zX6u89RKF6xlG8yPcGeM 6WoTXhC+MKwZV5QaTbLX/7wxxpk3Gal/iU+l01LJxJox69qHNVxFP0d8qjH/p25s gPRF62Pr+o1htKktgimrZM9I3ibmii/rXjptUvqg8P5FYCCnvqhKpmK4k0pmPkq4 SgXs3cO8IfkIQFXExRUi1ocMhzRSeIGKpqPe3y21p8wvrKkbdIuW286SQAUJ0/ax T1BYvHyG9Vkn8C8knOZpR6nP7DUxqce2V3uA== ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:to:subject:date:message-id:content-type :mime-version; s=arcseal; t=1687672416; bh=lL9/EmVBSUAmnWwDSB/FE qFmg1O6TaH7fjwEMQ3+Rs4=; b=rlNeqts1kgjCcHoci6KJ1UeP121np29EXOqaf mjd24g1oNyDzVajBvHthAjWfWs5+BAjQwUwKkFK0kCf9JGSjb9JhX8Jd+UkMxt3n 771OHgklIj3he9gSj36f5KZW4k+ME4slPPAHU6DZKdimUNdkoaOwL9y64EBOZ2Ws MTv5YhkPLpK5wT3qfoUVGjMGU2t5XCUrddY49y54DVb7bLfg9MLO4HkP5r6wGzRM A8SsNYvop/1yl6tUbQAjbQyCL3WB9CtoVbVHt2KWBVV2kiyjRSW8J9dm4fvkNKSj pN84YOfnkG2b7mHijIpau2MD5/EjoQ33rj3DehkfA3aMhBUIg== ARC-Authentication-Results: i=2; tb-mx1.topicbox.com; arc=pass (as.1.microsoft.com=pass, ams.1.microsoft.com=pass) smtp.remote-ip=40.107.94.130; bimi=skipped (DMARC did not pass); dkim=pass (2048-bit rsa key sha256) header.d=huntsmansnet.onmicrosoft.com header.i=@huntsmansnet.onmicrosoft.com header.b=XUULDJJg header.a=rsa-sha256 header.s=selector1-huntsmansnet-onmicrosoft-com x-bits=2048; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=huntsmans.net; iprev=pass smtp.remote-ip=40.107.94.130 (mail-mw2nam10on2130.outbound.protection.outlook.com); spf=pass smtp.mailfrom=ben@huntsmans.net smtp.helo=NAM10-MW2-obe.outbound.protection.outlook.com; x-aligned-from=pass (Address match); x-me-sender=none; x-ptr=fail smtp.helo=NAM10-MW2-obe.outbound.protection.outlook.com policy.ptr=mail-mw2nam10on2130.outbound.protection.outlook.com; x-return-mx=pass header.domain=huntsmans.net policy.is_org=yes (MX Records found: huntsmans-net.mail.protection.outlook.com); x-return-mx=pass smtp.domain=huntsmans.net policy.is_org=yes (MX Records found: huntsmans-net.mail.protection.outlook.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvhedrgeegledgheekucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpefhvffuth ffkfgtggesrgdttdertddtudenucfhrhhomhepuegvnhcujfhunhhtshhmrghnuceosggv nheshhhunhhtshhmrghnshdrnhgvtheqnecuggftrfgrthhtvghrnhepleeuvefggfehgf evffeiudeihfelkeejvdfhfeehveeileekkedvjeffveeigeeunecukfhppeegtddruddt jedrleegrddufedtpddviedtfeemuddtsgeimeeftddumeejvgemmedugeenucevlhhush htvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeegtddruddtjedrleegrddufedt pdhhvghloheppfetofdutddqofghvddqohgsvgdrohhuthgsohhunhgurdhprhhothgvtg htihhonhdrohhuthhlohhokhdrtghomhdpmhgrihhlfhhrohhmpeeosggvnheshhhunhht shhmrghnshdrnhgvtheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (huntsmans.net: Sender is authorized to use 'ben@huntsmans.net' in 'mfrom' identity (mechanism 'include:spf.protection.outlook.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="ben@huntsmans.net"; helo=NAM10-MW2-obe.outbound.protection.outlook.com; client-ip=40.107.94.130 Received: from NAM10-MW2-obe.outbound.protection.outlook.com (mail-mw2nam10on2130.outbound.protection.outlook.com [40.107.94.130]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sun, 25 Jun 2023 01:53:34 -0400 (EDT) (envelope-from ben@huntsmans.net) ARC-Seal: i=1; a=rsa-sha256; s=arcselector9901; d=microsoft.com; cv=none; b=WtAUzOAJK5al722eGbFcQ/5DqQpnQKpEaRBxxtjAr0MW4DUbs1oYfNvaimsvyMdP3ZtGgz3NeXojX1/w5w12TQrYqbR0Hk3DZlJ+YP/O7gtokcMNYN44XS4WCNywXZO+U0HA8/KiTFsk++b28mc3BQvdhZ7RF3Z1UOatk3bPFSxGbg0sna6PmpCW3EBshcKPawM9LWTHoBqnFZjNnWr/Zr8DUuCHvEJnjy0m83VtmsEqG5F+8Suv1LrbC4hYNGqh8jbIrNypxAUbF07+r6xDzZN0qetkQ6n85TL/b+L08JYLjxiRixRaOwZ4+Uoh9D5+7aU/Oo7fDy+mdsDQd/8mTQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com; s=arcselector9901; h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1; bh=lL9/EmVBSUAmnWwDSB/FEqFmg1O6TaH7fjwEMQ3+Rs4=; b=WwjB2sC8QXMJVzmy3Qqx6dnggvjxcpyYk9y64KTaSJn8Nm+ht4GIkTsy8uMw4ahv4PBOUyBTqtD9Abcustr3j9oLuuZt3xHr3BwaIY++qrwskM8c+qSEo+fJWnliYO1Z/YVgB2fpEBhV4LTOYwiADusYvbwefke61wweSLtjSqsKTMT6qE/yU8y3tYAxxgFwk7BKkwruxqnfeSc+t7ctRdzJvYQ5qcs7ISM+TsmbeYeeqWyyWcbkz5A2IAF73LmvTFBIkf4FgWwQ6vdtBV/OQ7/gda/Nkndk90bHzeIh/mH0WF0ur/w4nNAVw8k6iWse0T1BYz+bRdrupS58asGSIQ== ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=pass smtp.mailfrom=huntsmans.net; dmarc=pass action=none header.from=huntsmans.net; dkim=pass header.d=huntsmans.net; arc=none Received: from MWHPR0701MB3674.namprd07.prod.outlook.com (2603:10b6:301:7e::14) by DM8PR07MB8967.namprd07.prod.outlook.com (2603:10b6:8:d::21) with Microsoft SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.6521.24; Sun, 25 Jun 2023 05:53:30 +0000 Received: from MWHPR0701MB3674.namprd07.prod.outlook.com ([fe80::91e7:f935:f5bc:5c1]) by MWHPR0701MB3674.namprd07.prod.outlook.com ([fe80::91e7:f935:f5bc:5c1%7]) with mapi id 15.20.6521.024; Sun, 25 Jun 2023 05:53:30 +0000 From: Ben Huntsman To: "9fans@9fans.net" <9fans@9fans.net> Thread-Topic: 9vx Thread-Index: AQHZpyjkVIt/zp02IUi9WSTrjZf/UA== Date: Sun, 25 Jun 2023 05:53:30 +0000 Message-ID: Accept-Language: en-US Content-Language: en-US X-MS-Has-Attach: X-MS-TNEF-Correlator: msip_labels: x-ms-publictraffictype: Email x-ms-traffictypediagnostic: MWHPR0701MB3674:EE_|DM8PR07MB8967:EE_ x-ms-office365-filtering-correlation-id: f90bc6ea-8051-4866-8339-08db754080b2 x-ms-exchange-senderadcheck: 1 x-ms-exchange-antispam-relay: 0 x-microsoft-antispam: BCL:0; x-microsoft-antispam-message-info: QcMpMS7S/a6CLCgbw3lz4nO3AXfs7iCNc680PjoOUBrIGN+GPCObfZ7/hc+2BksFo4I75O7rKwcosr7AZZct75M+2UW9KmnVV5jbt/ROK/x19ui0CdZ85VoHZC2FU07PWHP3QcnLD+3f3O6reT8NtnPjFZENDF9LzU4pRp+MQX7R1CUk5lYn1nF8ZY9h7uot6FgX1hWrKrejUy5CxuaaTQiNQ0Zw8PlUBZLMrG8bwYea/1XAnh19gUOfkGY7+o3p+Vlz5N1qYOGhpUGiwcjtSMVicIw47SNPFcgPRHiPXYYc6LIJjxtYECEQFkgIPUlU62BzWpos0t8jOKJ+9Uc0sLn6ZfUGfpYqSuUzhn0W7cuqDrcGEkn8GGTfgba0i7e7ZPysKKZT0fUp0He+p8/Y9g+s9x0fZDNhgszNd6fmLPH7jDaqYcgAUc+JHfQWDvg1SOujlycBPT7EG8rMZdF9/9zcrNWd1+bDUt+CN0egrggB/nluvCQ29AFaQSgINSDmaG7OvUVi/vAbiXqSqHl/YEH3qoZG99/T1tkCVetRbvquHa6nr5b1g6MO7W6PxJE+KDqOMdMdH+4a2XEnG/40j5mOSJ8xccpCjhHecIfPvn/vunUpYtQJfQefNTaUVNs8 x-forefront-antispam-report: CIP:255.255.255.255;CTRY:;LANG:en;SCL:1;SRV:;IPV:NLI;SFV:NSPM;H:MWHPR0701MB3674.namprd07.prod.outlook.com;PTR:;CAT:NONE;SFS:(13230028)(366004)(376002)(39830400003)(136003)(396003)(346002)(451199021)(8936002)(8676002)(55016003)(64756008)(66446008)(66476007)(66556008)(6916009)(66946007)(76116006)(41300700001)(316002)(6506007)(9686003)(26005)(186003)(478600001)(71200400001)(7696005)(2906002)(4744005)(52536014)(5660300002)(38070700005)(38100700002)(122000001)(19627405001)(33656002)(86362001);DIR:OUT;SFP:1102; x-ms-exchange-antispam-messagedata-chunkcount: 1 x-ms-exchange-antispam-messagedata-0: =?iso-8859-1?Q?UlJEoXKQlm8KEnC8qgILYp67NzgA2jq0nueCinN0HjLW7CVSlp0BofZbzk?= =?iso-8859-1?Q?To9Q0g8wRV+l9s2mcsj+MGGlkhekvc/WQ0jYiQIm/LUakX47L45l8QHgum?= =?iso-8859-1?Q?9onOXUWQAJkP24i4c8WVbmI4epACS5rypdbntZZeQDKEY3OQZNqIztqO4J?= =?iso-8859-1?Q?7FMLWNBgp/Oq1VzM+uUSZgrCDCpjkMB+PM+Vr3FfmESClkomwWdgt91ku4?= =?iso-8859-1?Q?vJGciZwxK4wcdDv6+3YWulpkKB+TvCPBBr2RvgucRyVs8byDV96rAMcan5?= =?iso-8859-1?Q?RBvpX4z3BbXWyCHiPk3Y+8QdRZLSNnv1ZnY1hlUbsTFTf7r2LKLOlCCtlN?= =?iso-8859-1?Q?a78cReSd49y/1xfXzElDkvujJIPqMShV7Y02cx6f7IYtT4jm7IjLZ3C/p9?= =?iso-8859-1?Q?+4vqA4+QiJzrqshOKUExZTzUUtIdxqqE9VCRE8WdCaEFSlrzPUKBY60Y30?= =?iso-8859-1?Q?Q+4imacshrOR9iE12nCB/fap2VXbVL15Hf6HNX7qJ3OYen0UuQiaR7fzmo?= =?iso-8859-1?Q?/8zfZapBgfSCHAOR5Rn3QLGBNT37ImSK38QbDKFp7A7YjByl2S9LVaURi8?= =?iso-8859-1?Q?mNWEYms3FwlRAunheYvLztxFHe5ZvTF1uSWGchjx/mnAEqR2e1MOoHrErR?= =?iso-8859-1?Q?xiwgs0bKQUBW3C2xsxW2EYOsDb9FGS/iRIOwJ1dNRYW3XRvSEHN/Dk6KlO?= =?iso-8859-1?Q?H0pdAIxW87d+tpgnNx4ZYOg1BSMiIp99LC1bw9p2P7Hm+AnYJ9I1R/S2Ky?= =?iso-8859-1?Q?gBHHdWe7c5N//Ui61MFJ0Y7Xfq3MiJkAZIOSv4WbshLKPGSX1fuDmsuQ5o?= =?iso-8859-1?Q?731bJ2NSKLMdwGdsdNHBy42IrlyXSW2s9cUY+OrEqo4vXOnVxqIq+kkY89?= =?iso-8859-1?Q?E+8rLLTV1uvfl0F2CtpHxx9C2x7ZiHKBR5c48NONlfst3OOxU2uaggAeeM?= =?iso-8859-1?Q?xApHXYH8ixolfDpgH8JdbisBSU7FH/7czPzV1WUKUoZ636YNP4AuuGYCA9?= =?iso-8859-1?Q?d+O3zx8kBVtCZDfOeu6oroOoWf2HvyeZePf60fjZArITKCYzaBTg2EGE8Q?= =?iso-8859-1?Q?wYCaAxXk9r0+qnTRMhEz78KWOka2bAAxL8g3ChEbvzj2hXnjTnJGi2JLFo?= =?iso-8859-1?Q?hpnk7eVNYpjuCWU4Wbk/+2q0Nsn6Vm/C3xY+w18kj7wrsfIfJOads2SUi1?= =?iso-8859-1?Q?lbkG+KPNtF8nweagtwmRStDhTAkiBhPZI8J9BYyEgQmU8Qs+QkSSo7O6lS?= =?iso-8859-1?Q?7Bg8cpTbouhBbEudTNSpLZjv0PT7sa8Sw8pijs4VNzy08hUSxXZ29iVeiA?= =?iso-8859-1?Q?9lM78+M7I6lJPoGSVWwmMEVpO1r1nF1oIS6xyLsUphaPMbhIlvFyBlbE9y?= =?iso-8859-1?Q?sWgEzybyCdRCa0FZvCc1zTSpb1t42/zKoCCxEIro64D2WX7BwC3T8wjPa4?= =?iso-8859-1?Q?lRP7fd8udZHcMAFfL7HZ9XMvgHct0HmOom3t1gH+A48rtoxtBccZiFGM+2?= =?iso-8859-1?Q?vKaHHzhSq1wYfnEPN9agRDupFSoFA65H64lFqy378rFmV7/HSxWL1R9tZt?= =?iso-8859-1?Q?sszAwfkarcWycCvw9mNh3DJjqHwfOPsKmm6AopLAS85vEKC+Y8N4bsY274?= =?iso-8859-1?Q?Lv1W1EIgja8uE=3D?= Content-Type: multipart/alternative; boundary=_000_MWHPR0701MB367434745A2B67C56D5D5E7FA721AMWHPR0701MB3674_ MIME-Version: 1.0 X-OriginatorOrg: huntsmans.net X-MS-Exchange-CrossTenant-AuthAs: Internal X-MS-Exchange-CrossTenant-AuthSource: MWHPR0701MB3674.namprd07.prod.outlook.com X-MS-Exchange-CrossTenant-Network-Message-Id: f90bc6ea-8051-4866-8339-08db754080b2 X-MS-Exchange-CrossTenant-originalarrivaltime: 25 Jun 2023 05:53:30.0274 (UTC) X-MS-Exchange-CrossTenant-fromentityheader: Hosted X-MS-Exchange-CrossTenant-id: 4971b8e2-f460-4808-b102-068638160ea6 X-MS-Exchange-CrossTenant-mailboxtype: HOSTED X-MS-Exchange-CrossTenant-userprincipalname: i6x3gEuijv3non1aJgwAEtic0vtMYa4/8cLY8Y5sMxMdTynFPiqjnpWN463ozyZ1ALXrpaxm0FgyKzMNPXUxzg== X-MS-Exchange-Transport-CrossTenantHeadersStamped: DM8PR07MB8967 X-Received-Authentication-Results: (Received Authentication-Results header removed by tb-mx1.topicbox.com) dkim=none (message not signed) header.d=none;dmarc=none action=none header.from=huntsmans.net; Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: a2b64272-131c-11ee-9112-b18b6f702766 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMTM5MjFhMjVhZTQ3N2E2NS1NODI2MWMzYzRhNTJlNzE3NzU2YjY4?= =?UTF-8?B?ZTM5Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Subject: [9fans] 9vx Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M8261c3c4a52e717756b68e39:1:hwpo3haxAIRiBk3HC4v5JnHkWH5ZTZIontpJ9NHC49U --_000_MWHPR0701MB367434745A2B67C56D5D5E7FA721AMWHPR0701MB3674_ Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Hi there Does anyone still use 9vx for anything? Anyone ever look at adding a co= coa/metal GUI layer for more recent Mac OS X? I'm looking at drawterm-coco= a as a starting point. This is a losing game for sure, since Apple dropped 32-bit binary suppor= t, but most of the project still compiles with XCode 9.4.1 under Mojave... = Another interesting project would be seeing if it could be modified to wor= k as a 64-bit binary but still running a 32-bit environment on the inside... Thanks much, as always! -Ben ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T13921a25ae477a65-M8261c= 3c4a52e717756b68e39 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --_000_MWHPR0701MB367434745A2B67C56D5D5E7FA721AMWHPR0701MB3674_ Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Hi there
   Does anyone still use 9vx for anything?  Anyone ever look= at adding a cocoa/metal GUI layer for more recent Mac OS X?  I'm = looking at drawterm-cocoa as a starting point.

   This is a losing game for sure, since Apple dropped 32-bit bin= ary support, but most of the project still compiles with XCode 9.4.1 under = Mojave...  Another interesting project would be seeing if it could be = modified to work as a 64-bit binary but still running a 32-bit environment on the inside...

   Thanks much, as always!

-Ben

= --_000_MWHPR0701MB367434745A2B67C56D5D5E7FA721AMWHPR0701MB3674_-- From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE,T_SCC_BODY_TEXT_LINE autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 30715 invoked from network); 25 Jun 2023 19:00:31 -0000 Received: from tb-ob0.topicbox.com (64.147.108.117) by inbox.vuxu.org with ESMTPUTF8; 25 Jun 2023 19:00:31 -0000 Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 7CCA01C952 for ; Sun, 25 Jun 2023 15:00:29 -0400 (EDT) (envelope-from bounce.mM6dd9563dccda0b3a2930cdfd.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 7A682159D263; Sun, 25 Jun 2023 15:00:29 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=NaIKDyBV header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=0intro@gmail.com smtp.helo=mail-ej1-f47.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:message-id:in-reply-to:references :date:from:to:subject:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1687719629; bh=biK8nK8xD7YU4TWn jTZkIh//ar2qiR3LGhRpZ4K7C7Y=; b=BDrRtQud1PnkvZcRYpF37HNj2BEKJMjd QZeW+z8c9qTSKXRgDqHFAX/EE0EmqwMtJN7wd2pdREOouXo/+05K6SxBsf4b2ndT c2r0i2wz8GQA2HmV/rw1LKdKoGop+yfiCd2HGxkKe3W5A3zZ866YQgsoffGF4Ab/ VfbLDd25Q4k= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1687719629; b=CgQkY3z2vPcG68lsuYyD4Hx9R8j9eo/bfppp4NcSr5SC3UjhYp sKY1p+2JkH2qqiengxTzijAiWWa7m00/DQxDSgJRSZdAzwY4SYD0pkiex1suuWve iQojbBexY6nRL+lsBYC384kWWGGTI3+F8ZlmdbiWzMFdHaq2rBujGYjDI= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=NaIKDyBV header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=0intro@gmail.com smtp.helo=mail-ej1-f47.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=NaIKDyBV header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.218.47 (mail-ej1-f47.google.com); spf=pass smtp.mailfrom=0intro@gmail.com smtp.helo=mail-ej1-f47.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=P6KKGxUE; x-me-sender=fail; x-ptr=pass smtp.helo=mail-ej1-f47.google.com policy.ptr=mail-ej1-f47.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:message-id:in-reply-to:references:date:from:to :subject:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1687719629; x=1687806029; bh=SafOXo+iWqnOrDfa1/sU6fg+GzlFkRZO JHaA8pBdC/g=; b=dz4qKIxqn0dEBQqvhah62ge5kcKb7Wtj0W/AX3VNolQy0w8g FbyrU0GqJiq17nJufCmP+tkwSEg0LsHUfmcwnUUK7IdN10v+mEj7cd4yx05lFH2B ExB7ZGw6uuQznmBjbbCTD38mHKQefpCiiJuxkI3jzokJbhS0VS6XXYGrlME= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id C5E09159CE1A for <9fans@9fans.net>; Sun, 25 Jun 2023 15:00:16 -0400 (EDT) (envelope-from 0intro@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 10C265CB7BC; Sun, 25 Jun 2023 15:00:16 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1687719616; b=wu7YnrfAl5ZcDiK188orOXs/LdLTjys5T2OGqIb9W+zRafJ2OV G/7F2P+z78UGZ/bbOFnWpszj1MwKoqfMrRmomnmU3TWoXcqeblUkVx5NM+yOKoHr vTbG2+AXLq9jkuncevo+q+DlL5LFpYbRsOR/Z0Xv2GoiLV2q5mJylmEj3Go0Aw1G yI8rblJtJBa/cS87jSjy/stuTj/0selps1czZG6gT5cI7BEplI37qF9WM5g2X6bq NlHb05LJB82Vk2LZRcRj2UL1iR4UzKfLZqad6A78MfXLA9TRppvA7FZRIHiarOwg sgU2C5AtSBC0Q1PQub1lHrfmVi56ny7940ZQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:message-id:in-reply-to:references :date:from:to:subject:content-type; s=arcseal; t=1687719616; bh= ircNinya3/hqF2OPYSIJ11SQv+g9aHtFSBvJZzvvMkQ=; b=g6TEJfEcMh+HNDFe 6+B6KFHWQ+hvYmZDMCHymbdP02q6AvMfR3zeTNuXt46TPdCLaEaDrizFn+r+DGj8 ST8WFhk8PwusQ0KAGLUAOre3tBizAkZ9EYND8gf3TVDawJX8OAvtNrkJAbUl1gz8 mqotbXX7XuytykhyuLVBtSu5GA8sQF1iofpeTGOgPqX4OOjTecO9NqCoK79+jxMK THfBIMRdGZ1Ba4Gu0nApktiBcu/nRSqzpx7jzIsK8vP/hocGAtPizspDZD3dwGy0 ejmIJwkPYYvwjPUwrIjYTiFLGEdmcET0DFSePp8si8mhGF+Rfr4jPBiu5HxV0lfF osIR+g== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=NaIKDyBV header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.218.47 (mail-ej1-f47.google.com); spf=pass smtp.mailfrom=0intro@gmail.com smtp.helo=mail-ej1-f47.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=P6KKGxUE; x-me-sender=fail; x-ptr=pass smtp.helo=mail-ej1-f47.google.com policy.ptr=mail-ej1-f47.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvhedrgeehtddguddvlecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhepofgfgg fkjghffffhvffutgesthdtredtreertdenucfhrhhomhepfdffrghvihguucguuhcuveho lhhomhgsihgvrhdfuceotdhinhhtrhhosehgmhgrihhlrdgtohhmqeenucggtffrrghtth gvrhhnpeejleduleeftdefjefhgeejveelgeelteelffduleeffeekvdfftddufeegffdv veenucfkphepvddtledrkeehrddvudekrdegjedpieeirdduuddurdegrddvvdeknecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudek rdegjedphhgvlhhopehmrghilhdqvghjuddqfhegjedrghhoohhglhgvrdgtohhmpdhmrg hilhhfrhhomhepoedtihhnthhrohesghhmrghilhdrtghomheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use '0intro@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="0intro@gmail.com"; helo=mail-ej1-f47.google.com; client-ip=209.85.218.47 Received: from mail-ej1-f47.google.com (mail-ej1-f47.google.com [209.85.218.47]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sun, 25 Jun 2023 15:00:16 -0400 (EDT) (envelope-from 0intro@gmail.com) Received: by mail-ej1-f47.google.com with SMTP id a640c23a62f3a-986d8332f50so314483566b.0 for <9fans@9fans.net>; Sun, 25 Jun 2023 12:00:15 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20221208; t=1687719615; x=1690311615; h=subject:to:from:date:references:in-reply-to:message-id:mime-version :user-agent:feedback-id:x-gm-message-state:from:to:cc:subject:date :message-id:reply-to; bh=ircNinya3/hqF2OPYSIJ11SQv+g9aHtFSBvJZzvvMkQ=; b=P6KKGxUEnFVV7XPXlugVh2QAEFol3gxYuP4Apt3/0UQou1gsxOAyO+RTDgOVPBaRCp CsjMp11IBT3Vq4AynsCKC5BJwvOdFj6xHqRiVLzoP+g+cxtdEAwvhj+uBqySpdrOXbBJ SjdCeJfvXtkd+U/boNUa9vrrWD0pLuarU3dW46RD8T1XNHcSYgVQwVbpsdEe+cUzD/Vp ozhvOKDgbBgAw8WBv9XNUvfTTrT6F70QefYhCw9pnRItXKn51VucMrKX5I7GyklA5+OZ EWVZDGug48+owxtyPTIz0gT5COU68yO1/nfsHzKAC3Cquh+mfSJTosVq2KEqtPcGSaV4 ohMQ== X-Gm-Message-State: AC+VfDxapAls3dQG1DzGgZcFWqBcHcfOYMD/HrbexLBG/nYESfO/21gt yNdN5vepuu8qjNjNXc463sJLVSiEGLc= X-Google-Smtp-Source: ACHHUZ64mOJeUCkc2bt4DdrcjsSihwRA6Qbtdvrmznzl+t+O2DzW0GfRA4kDZoi72zpcDrFJhJju0Q== X-Received: by 2002:a17:906:5d0c:b0:988:6e75:6b3d with SMTP id g12-20020a1709065d0c00b009886e756b3dmr19889180ejt.33.1687719614763; Sun, 25 Jun 2023 12:00:14 -0700 (PDT) Received: from auth2-smtp.messagingengine.com (auth2-smtp.messagingengine.com. [66.111.4.228]) by smtp.gmail.com with ESMTPSA id ci8-20020a170906c34800b00982d0563b11sm2362719ejb.197.2023.06.25.12.00.13 for <9fans@9fans.net> (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Sun, 25 Jun 2023 12:00:14 -0700 (PDT) Received: from compute6.internal (compute6.nyi.internal [10.202.2.47]) by mailauth.nyi.internal (Postfix) with ESMTP id D321F27C0054 for <9fans@9fans.net>; Sun, 25 Jun 2023 15:00:12 -0400 (EDT) Received: from imap44 ([10.202.2.94]) by compute6.internal (MEProxy); Sun, 25 Jun 2023 15:00:12 -0400 X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvhedrgeehtddguddvlecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfgh necuuegrihhlohhuthemuceftddtnecunecujfgurhepofgfggfkjghffffhvffutgesth dtredtreertdenucfhrhhomhepfdffrghvihguucguuhcuveholhhomhgsihgvrhdfuceo tdhinhhtrhhosehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeejleduleeftd efjefhgeejveelgeelteelffduleeffeekvdfftddufeegffdvveenucevlhhushhtvghr ufhiiigvpedtnecurfgrrhgrmhepmhgrihhlfhhrohhmpegujhgtodhmvghsmhhtphgruh hthhhpvghrshhonhgrlhhithihqdekheekieduudehvddqudeluddtheejhedvqddtihhn thhroheppehgmhgrihhlrdgtohhmsegsihhtsgdrlhht X-ME-Proxy: Feedback-ID: i16f944b0:Fastmail Received: by mailuser.nyi.internal (Postfix, from userid 501) id 3373136A0073; Sun, 25 Jun 2023 15:00:12 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface User-Agent: Cyrus-JMAP/3.9.0-alpha0-499-gf27bbf33e2-fm-20230619.001-gf27bbf33 Mime-Version: 1.0 Message-Id: <0ebf221a-c84a-4e98-89b1-68641854a8c7@app.fastmail.com> In-Reply-To: References: Date: Sun, 25 Jun 2023 20:59:52 +0200 From: "David du Colombier" <0intro@gmail.com> To: "Glenn Holmer" <9fans@9fans.net> Subject: Re: [9fans] 9vx Content-Type: text/plain; charset=UTF-8 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 8952f42e-138a-11ee-8627-9f06c403b34a Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMTM5MjFhMjVhZTQ3N2E2NS1NNmRkOTU2M2RjY2RhMGIzYTI5MzBj?= =?UTF-8?B?ZGZkPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: quoted-printable List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M6dd9563dccda0b3a2930cdfd:1:fOxNSK64DCkArcuhHTmAlr6lABVAG1X1G5jWR3di46I > Does anyone still use 9vx for anything? Anyone ever look at adding=20 > a cocoa/metal GUI layer for more recent Mac OS X? I'm looking at=20 > drawterm-cocoa as a starting point. > > This is a losing game for sure, since Apple dropped 32-bit binary=20 > support, but most of the project still compiles with XCode 9.4.1 under=20 > Mojave... Another interesting project would be seeing if it could be=20 > modified to work as a 64-bit binary but still running a 32-bit=20 > environment on the inside... I'm using 9vx daily, but on Linux only. --=20 David du Colombier ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T13921a25ae477a65-M6dd95= 63dccda0b3a2930cdfd Delivery options: https://9fans.topicbox.com/groups/9fans/subscription From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE,T_SCC_BODY_TEXT_LINE autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 27922 invoked from network); 26 Jun 2023 09:28:59 -0000 Received: from tb-ob20.topicbox.com (173.228.157.66) by inbox.vuxu.org with ESMTPUTF8; 26 Jun 2023 09:28:59 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob20.topicbox.com (Postfix) with ESMTP id EB90B2B9A5 for ; Mon, 26 Jun 2023 05:28:56 -0400 (EDT) (envelope-from bounce.mM4468dd505f1dd37b95637658.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id ADDD51EBCEBF; Mon, 26 Jun 2023 05:28:56 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=TFZtYiTS header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=morrow.stuart@gmail.com smtp.helo=mail-vs1-f41.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1687771736; bh=7uQZfkacthTrqMA/ xFkxl+GnYXc/UWmHLn5ziF9gAbc=; b=ElxpVDfs/OY8AC4q4EWRXlxR4hxZVYKn 1y7uTPYbmv/Gon0nyHGJP8Ll0k679QrteVovEy9fWbmdbgO2hYaZoxuXhH24LnWK a+56g856YO+WDc4tLUYUoXXs1ygp5NX8COLDxtAUNnsu921t5Nz7aW8WU/rQtyfi GsOpKf9EqJA= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1687771736; b=rXkf96ZQh5WSCewanKsSwH5yQ9cDAWKd/7qnoGywE7XuCXzTHp s/I8y96Cl+x+U1WFwPeQy5TBvHR3jernuzjQInqyh/Uy08EKkbyps3G+YbEvdPBa o+nTNL16mOdGUua1Z+THNY5YRXlQwWtjJYklBzYAV7fD+8PMMwDEUNCH4= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=TFZtYiTS header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=morrow.stuart@gmail.com smtp.helo=mail-vs1-f41.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=TFZtYiTS header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.41 (mail-vs1-f41.google.com); spf=pass smtp.mailfrom=morrow.stuart@gmail.com smtp.helo=mail-vs1-f41.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=ShDhvUeD; x-me-sender=none; x-ptr=pass smtp.helo=mail-vs1-f41.google.com policy.ptr=mail-vs1-f41.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:in-reply-to:references:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1687771736; x=1687858136; bh=7uQZfkacthTrqMA/xFkxl+GnYXc/UWmH Ln5ziF9gAbc=; b=kuMHzp73KNrRFDHlnastId4sMKGowdJqC8HZ2q97NgcFKKrV agAkL/C4+EUMWpnk0opZOGXsclnb1yCd4pz+4/LKY84w7DuMIh0N4tnKNiHHrEsR lDUa+P/qFKPqG9ubYq0QrbrJ09m4dkOWWEvZdnWSai96esqgfjS2HgmlIQQ= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 748561EBCA7A for <9fans@9fans.net>; Mon, 26 Jun 2023 05:28:38 -0400 (EDT) (envelope-from morrow.stuart@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 39DABBF8058; Mon, 26 Jun 2023 05:28:38 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1687771718; b=Usov2Ydvub35TNOpgnhOec0yCYlfovzvuRGThoDVyNoEGHin8x qbVjsubO4nU1+fn1uw3v7tFZR/P7ib8M2eDI2FShIPE2ZKjm3zNhFdyONHo4RTYf Wt7vui/oJMqIuWsC6Tt3miyRQQHOBH+CDbQ8WX8k418QIUZhkTQI0GbG8YaemWGv VR1H+fJzFqGGzlqmbLGk4rFfKuAtL69NnrfJkHKlyH8QUrrDc3UJXFTopUtNz/6M wVs9dP222OBJEDj+ybRnr6aPEDkG8xaZZE9DQaTnhlbzLRr50fdQFrtaUHVKDRyS S0w0uyVPExLZe0ywuPh5C45VG3gTt9Y1aLCg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type; s=arcseal; t=1687771718; bh=B9bDiz31eyvANBL2gHF22evZCnUplRiLehHyEHjXK/c=; b=oZ7T01QHV/Ql ycEqxPCRgqOs/gXZ0pIvt/BrdV4r8cS0gU+7S/kwJ5KjLaoT8dQGFeFDBWOujA82 476O9iKWkO6w8HABpqevp1owHenP3aOYDT81iGaNqc1xk1MLpA3zCiy0yPUADO2G IUqUES5pZxyXgQnNLA/rmiTdCDbsgrSs4ETtWOUlCT70ruPxBsDJNIvJVLGx5FWO Qdg1bTpdOMUvtb02GTe1lS3Es8FIhEMtBmBJs80re+haIEXDQ2nNi7QOuNeUGxzS Dhw4vEW1BFK/xkoTHT1mBnYJexgv9x9DmD+t+ajNLR6K2Z2+NzGG4e12Xmjndu24 +HrNIVd+sg== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=TFZtYiTS header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.41 (mail-vs1-f41.google.com); spf=pass smtp.mailfrom=morrow.stuart@gmail.com smtp.helo=mail-vs1-f41.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=ShDhvUeD; x-me-sender=none; x-ptr=pass smtp.helo=mail-vs1-f41.google.com policy.ptr=mail-vs1-f41.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvhedrgeehfedgudefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpegjfhfhff fkuffvtgesthdtredttddtjeenucfhrhhomhepufhtuhgrrhhtucfoohhrrhhoficuoehm ohhrrhhofidrshhtuhgrrhhtsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpe dutddvvddufedvgffhhedutdfhfeeilefgfedtfefgiedvkedvhfeludevudeifeenucff ohhmrghinhepmhhithdrvgguuhenucfkphepvddtledrkeehrddvudejrdegudenucevlh hushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddujedr gedupdhhvghlohepmhgrihhlqdhvshduqdhfgedurdhgohhoghhlvgdrtghomhdpmhgrih hlfhhrohhmpeeomhhorhhrohifrdhsthhurghrthesghhmrghilhdrtghomheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'morrow.stuart@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="morrow.stuart@gmail.com"; helo=mail-vs1-f41.google.com; client-ip=209.85.217.41 Received: from mail-vs1-f41.google.com (mail-vs1-f41.google.com [209.85.217.41]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Mon, 26 Jun 2023 05:28:37 -0400 (EDT) (envelope-from morrow.stuart@gmail.com) Received: by mail-vs1-f41.google.com with SMTP id ada2fe7eead31-440ac4b44a8so830676137.3 for <9fans@9fans.net>; Mon, 26 Jun 2023 02:28:37 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20221208; t=1687771717; x=1690363717; h=to:subject:message-id:date:from:references:in-reply-to:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=B9bDiz31eyvANBL2gHF22evZCnUplRiLehHyEHjXK/c=; b=ShDhvUeDRsPIdX0IrSZt7+wnbSVWyKiknFcU16GjZkcpjdAeIn/sKPechH4SI14LMN q+NDbWlvpbpsaNc/4hmiDp5e/D6YYysDlWt6J6FiJRsIRb3w5FxTvEMISDQmUTPmvnFG +Au6XTrOZoM2dV5cWecWeUEScSR9vW2niXO+5zOqiHQrFibrzpP/B029KbTcfwXHZEZI o26/r7yhE3fMvZJDh/c4gHuaiNtN+nB8dEAMUFb1v6R/mPluVQuSbmv8s9GvGoxSW6X7 2H7GukWAAT/i8bveS1ceJLAnieDDyLreRCZLOrsxyqcOTwzzsGPuKixvNlPrME1z+G9W 6Ndg== X-Gm-Message-State: AC+VfDxtlaVujRfPoSnQ3hZnXS7pOvHqqXT4AwDZ+tALrxifjJSdY0Qn 5ETFX0u9BaSILc4Ao6vJ9hsinGKUjauiZ0RcG/O2W9g9 X-Google-Smtp-Source: ACHHUZ7ecuMFCpKPwkpy56S0IqFy7Y4CNTV4StDTQXUf2wQEt/q8k5QuwmDgTYloI07fhJy01zd118Qmfwbpb7g9C3k= X-Received: by 2002:a67:fbda:0:b0:440:cf49:f3bf with SMTP id o26-20020a67fbda000000b00440cf49f3bfmr8266837vsr.26.1687771717151; Mon, 26 Jun 2023 02:28:37 -0700 (PDT) MIME-Version: 1.0 Received: by 2002:a05:7000:53d1:b0:4e4:20e4:1bd7 with HTTP; Mon, 26 Jun 2023 02:28:36 -0700 (PDT) In-Reply-To: References: From: Stuart Morrow Date: Mon, 26 Jun 2023 10:28:36 +0100 Message-ID: Subject: Re: [9fans] 9vx To: 9fans <9fans@9fans.net> Content-Type: text/plain; charset=UTF-8 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: d7aed380-1403-11ee-b9b5-0fa0038c7b06 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMTM5MjFhMjVhZTQ3N2E2NS1NNDQ2OGRkNTA1ZjFkZDM3Yjk1NjM3?= =?UTF-8?B?NjU4Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: quoted-printable List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M4468dd505f1dd37b95637658:1:CC6YXCkO4BYOgBVSynJ9tBa9WxbbMuGdK-FQEWTNZeI > Another interesting project would be seeing if it could be > modified to work as a 64-bit binary but still running a 32-bit environment > on the inside... https://pdos.csail.mit.edu/papers/vx32:usenix08/#:~:text=3DThe%20recent%206= 4,bit%20host%20application. This needs to happen. I'd use it. ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T13921a25ae477a65-M4468d= d505f1dd37b95637658 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,MAILING_LIST_MULTI, T_SCC_BODY_TEXT_LINE autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 4127 invoked from network); 26 Jun 2023 13:40:24 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 26 Jun 2023 13:40:24 -0000 Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 53979195C2 for ; Mon, 26 Jun 2023 09:40:18 -0400 (EDT) (envelope-from bounce.mM88a880c0f59a83705d10b847.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 4DB8415A9AAF; Mon, 26 Jun 2023 09:40:18 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=CbMtQ8bP header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-vs1-f51.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1687786818; bh=JKWKuzpPq49xcJet gZnFgr6d/fzkxNHbvOBmoY6YHcY=; b=NnckFc6AHHzv/1ycfIYsSXR7vdpH6x4o qk1Gn8qtTLxFThItYCYRxGKhJPabgTKXBiIU35Ep8wWsYubTw5b92tbUmqVrhS2T GjjGnqSeYkQjD3goM/f6ukLCvf0/RvT9pr84j0ePgIyiVOwOeW8N6amQaE1IPFAU lwW2bcIWBkA= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1687786818; b=KMCNa/zyPIZywRS5tYw6ZeTbFoRYyu7oQEVC0/5lCVRRc6kaXx c5QcqiddseU9URjxJq+7k6rnh4R5xfH5qBi49+DEyEhyjV30BzEPTQqWkXhfJzxE cmUs3IivDXhH74ZxCX0K4hq/mgAroBCB/QLWOqKc91BdTPkKDkRYn7jLY= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=CbMtQ8bP header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-vs1-f51.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=CbMtQ8bP header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.51 (mail-vs1-f51.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-vs1-f51.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=MQvkCTFk; x-me-sender=none; x-ptr=pass smtp.helo=mail-vs1-f51.google.com policy.ptr=mail-vs1-f51.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:in-reply-to:references:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1687786818; x=1687873218; bh=JKWKuzpPq49xcJetgZnFgr6d/fzkxNHb vOBmoY6YHcY=; b=LFOkWItMG9ZcG8V/s51UruDaOg7vie0CXDtkmKV6h5LM5dL0 QCr/shLRwrgAStYYdWUAtCfkKkwLbdg3+dJKsGOSIaR9itdwlfJ6XhBDfdCZ8BPi gJnCaCNP6tKRr5rFlCVSNJy0oJ28qXc89PtRPFfdeOyYjZsk0550dNRMZJU= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id BDE9B1EC1437 for <9fans@9fans.net>; Mon, 26 Jun 2023 09:40:01 -0400 (EDT) (envelope-from 23hiro@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id C7479931C74; Mon, 26 Jun 2023 09:40:01 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1687786801; b=c0jY2yluzHJ05IKeAh/42tzx5D65U0RXGQlgwl2YJ7LBl4g5J1 qFOEsTgU9uJcEv/ijf1r5pS8V8DcA3aIxz16MjU7p3CxZzzEWqfxz/SAfSPLH+nk S0TSgJ3faL1OERacVdr9/wQqFF0Xy7Y6zqTVESalY/YTYBlDODHcO4cZxm06G8fR rfO47jgp2vx6CTPARwCFcliPAuoxnBfMWUIP0/kCdbim8LcVWbVB7+pCSiwviABU SQeSs4TZvqTNdPAgY1H6DUlisHfFnf3jy/sE/JQAaw+mcRimDjsSXsZrXDUauVlw g9+2z3sAOJTvTOo+xVbkngXv+UfILY5VlrdQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type; s=arcseal; t=1687786801; bh=otBCm3WTpZ6hmULaStTz8d8ws/sQeRlRbj0HS32Wmso=; b=J1WKFOqurMIX Oaw/7WWA31rzKgJrYcOvXV00czBV/OEHHjJA1yuZLE+39WHiGVytikdOG+14DqSg ZSQ9lCTr+Z9GlGaEiQyROEhiE4MBWSCI0pMh5qq0MBMAaWsTCVfbybsVUj/qhWff QHb5wPp+TiuOCEqCdNswxc96MzuYrQQzM+0BMHVBwO9QFa9wwEhL/RrPqnvnbZA8 q8w87yIs8eJwMH1oKG4Y6GImS9kCsEPgyR8CnQNCJf5t2El4XpZcwY1jkF1ZifQb eQ5yWHNYeo5hV3pFUmXfEix4k9iR6fdK47bD71C4zU5H/hGCEHi5+O+0V724W0Eo Ytvw/Fy+yQ== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=CbMtQ8bP header.a=rsa-sha256 header.s=20221208 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.51 (mail-vs1-f51.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-vs1-f51.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=MQvkCTFk; x-me-sender=none; x-ptr=pass smtp.helo=mail-vs1-f51.google.com policy.ptr=mail-vs1-f51.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvhedrgeehfedgieefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpegjfhfhff fkuffvtgesthdtredttddtjeenucfhrhhomhephhhirhhouceovdefhhhirhhosehgmhgr ihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeehueevgfffgfefhfelgeeuudelgeduge etkeettdefleegffeifffftdfhffduvdenucffohhmrghinhepfigvsgdruggvvhdpmhhi thdrvgguuhdpthhophhitggsohigrdgtohhmnecukfhppedvtdelrdekhedrvddujedrhe dunecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeeh rddvudejrdehuddphhgvlhhopehmrghilhdqvhhsuddqfhehuddrghhoohhglhgvrdgtoh hmpdhmrghilhhfrhhomhepoedvfehhihhrohesghhmrghilhdrtghomheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use '23hiro@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="23hiro@gmail.com"; helo=mail-vs1-f51.google.com; client-ip=209.85.217.51 Received: from mail-vs1-f51.google.com (mail-vs1-f51.google.com [209.85.217.51]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Mon, 26 Jun 2023 09:40:01 -0400 (EDT) (envelope-from 23hiro@gmail.com) Received: by mail-vs1-f51.google.com with SMTP id ada2fe7eead31-440d44c600dso117223137.1 for <9fans@9fans.net>; Mon, 26 Jun 2023 06:40:01 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20221208; t=1687786800; x=1690378800; h=to:subject:message-id:date:from:references:in-reply-to:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=otBCm3WTpZ6hmULaStTz8d8ws/sQeRlRbj0HS32Wmso=; b=MQvkCTFkxkJ4+gnwYLronLYITYpYvs5vnS1MdtBNrGDYnODsOxqAtoF+iHr7Dz+Czv y/D8VN5bTncZBz1xvMLY2N+Nb/6d5kGL/7SmAdqqrEYEjPKhPuYfALksjXfgJqC4jvFS ohEFxiW4MczNeih9ErNeJNGcPJxmRo0nrNuLJbJQawJY2OriAzQlua3BWPNBLooEk+yX UT25+0RfrjgVLn3uy0TmTN6/rAJKdQYulTkD1pcEzxva0xGpbSRwohPlTMdJAGvRF17G c/mebjMgz+NiPxSMYwlSZrjyxWadYzQGA1UC6DqQn7GlIFrpQMkLYmSLZVfKOE4TogrD C3jw== X-Gm-Message-State: AC+VfDyuhITBdDalQKHFkykl8+ujXVUITlDhKugm/xbq/82j0Ute2atX Hx0ok416mg2GOVapxkny2lbYSkfmAlvnBEf+4uQWeLVr X-Google-Smtp-Source: ACHHUZ737rZ2yFbiyt3cap1kpRePsitBUtIhwzfdKiveouBu4wR22xaQb25rLnrhHFeqTqq+pn5lLlZB3WDx75dDMG8= X-Received: by 2002:a05:6102:3082:b0:440:b96f:d146 with SMTP id l2-20020a056102308200b00440b96fd146mr7552766vsb.3.1687786800509; Mon, 26 Jun 2023 06:40:00 -0700 (PDT) MIME-Version: 1.0 Received: by 2002:ab0:2251:0:b0:794:31b0:e00a with HTTP; Mon, 26 Jun 2023 06:39:59 -0700 (PDT) In-Reply-To: References: From: hiro <23hiro@gmail.com> Date: Mon, 26 Jun 2023 15:39:59 +0200 Message-ID: Subject: Re: [9fans] 9vx To: 9fans <9fans@9fans.net> Content-Type: text/plain; charset=UTF-8 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: f9071920-1426-11ee-a92f-15c0088c7b06 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMTM5MjFhMjVhZTQ3N2E2NS1NODhhODgwYzBmNTlhODM3MDVkMTBi?= =?UTF-8?B?ODQ3Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: quoted-printable List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M88a880c0f59a83705d10b847:1:u130joMV2d7NkeP_RDnX-0ha-N1bt0gU4DrFSxJ1j0s in case somebody else is wondering what Stuart is talking about, he's referencing a specific text passage using one of these google chrome specific features: https://web.dev/text-fragments/ On 6/26/23, Stuart Morrow wrote: >> Another interesting project would be seeing if it could be >> modified to work as a 64-bit binary but still running a 32-bit >> environment >> on the inside... >=20 >=20 > https://pdos.csail.mit.edu/papers/vx32:usenix08/#:~:text=3DThe%20recent%2= 064,bit%20host%20application. >=20 > This needs to happen. I'd use it. ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T13921a25ae477a65-M88a88= 0c0f59a83705d10b847 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.1 required=5.0 tests=DKIM_SIGNED,DKIM_VALID, DKIM_VALID_AU,HTML_MESSAGE,MAILING_LIST_MULTI,RCVD_IN_DNSWL_NONE, T_SCC_BODY_TEXT_LINE autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 11509 invoked from network); 26 Jun 2023 17:49:50 -0000 Received: from tb-ob21.topicbox.com (173.228.157.67) by inbox.vuxu.org with ESMTPUTF8; 26 Jun 2023 17:49:50 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob21.topicbox.com (Postfix) with ESMTP id 97EB41945F for ; Mon, 26 Jun 2023 13:49:48 -0400 (EDT) (envelope-from bounce.mM2906ba611422c3ebd4e2fa7e.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 59D421ED2C71; Mon, 26 Jun 2023 13:49:48 -0400 (EDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h=to:subject :message-id:references:in-reply-to:date:mime-version :content-type:content-transfer-encoding:list-help:list-id :list-post:list-subscribe:reply-to:from:list-unsubscribe; s= dkim-1; t=1687801788; x=1687888188; bh=d7GV3/TtcPvxe8najoQChDLx0 trbM6tGtJ0lLLat0gg=; b=E0kfYsYgGhy4ORymD8lvqeMegFLWjWtYxe9tNn+8Z bdeJXUKUkUllnCHMN9YSnAhIWYOya6KTpRRgdAI8hA61/WKDJEsUtb8sL66EFvll WS47kYk214YZ/kKRB4xMMGR13t1M7MDNwdsXbPBgMDAMeXhb/OmOOX+m63paZZa4 48= To: 9fans <9fans@9fans.net> Subject: Re: [9fans] 9vx Message-Id: <16878017830.10f1f1.635001@composer.9fans.topicbox.com> References: In-Reply-To: Date: Mon, 26 Jun 2023 13:49:43 -0400 MIME-Version: 1.0 Content-Type: multipart/alternative; boundary=16878017831.EDaC89A.635001 Content-Transfer-Encoding: 7bit Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: d50a70f8-1449-11ee-a1cb-5344262d11b0 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMTM5MjFhMjVhZTQ3N2E2NS1NMjkwNmJhNjExNDIyYzNlYmQ0ZTJm?= =?UTF-8?B?YTdlPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> From: "ibrahim via 9fans" <9fans@9fans.net> List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M2906ba611422c3ebd4e2fa7e:1:kiPvw5bBxZRtNYU5jnrUv94mGwCm-5wyoRg-1kCWXCI --16878017831.EDaC89A.635001 Date: Mon, 26 Jun 2023 13:49:43 -0400 MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable I'm using it on a daily base for development and as a server plattform.=20 9vx is my terminal, while I use geany editor from linux as an editor. 9p fi= lesystems can easily be started for data transfer with native 9legacy. The = only feature I miss in 9vx is the lack of some plan9 devices in my case the= #g (segment) device which I use for shared memory on 9legacy forks to crea= te my graphical framebuffer and font infrastructure. But there is a simple = workaround for this problem so I don't mind it too much.=20 9vx is extremly fast I can compile the kernel and userland in less than 2 m= inutes and the greatest advantage is the ability to use the underlying host= filesystem directly from within linux.=20 When I started kernel development with 9legacy after the licence changes I = was looking for some way to exchange data between host and guest when someo= ne pointed me to 9vx and afterwards it became my "thats it" solution. ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T13921a25ae477a65-M2906b= a611422c3ebd4e2fa7e Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --16878017831.EDaC89A.635001 Date: Mon, 26 Jun 2023 13:49:43 -0400 MIME-Version: 1.0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
I'm using it on a daily base for developme= nt and as a server plattform.

9vx is my t= erminal, while I use geany editor from linux as an editor. 9p filesystems c= an easily be started for data transfer with native 9legacy. The only featur= e I miss in 9vx is the lack of some plan9 devices in my case the #g (segmen= t) device which I use for shared memory on 9legacy forks to create my graph= ical framebuffer and font infrastructure. But there is a simple workaround = for this problem so I don't mind it too much.

9vx is extremly fast I can compile the kernel and userland in less= than 2 minutes and the greatest advantage is the ability to use the underl= ying host filesystem directly from within linux.

When I started kernel development with 9legacy after the licence ch= anges I was looking for some way to exchange data between host and guest wh= en someone pointed me to 9vx and afterwards it became my "thats it&quo= t; solution.

= --16878017831.EDaC89A.635001--