From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.9 required=5.0 tests=DKIM_SIGNED,DKIM_VALID, HTML_MESSAGE,MAILING_LIST_MULTI,RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H4, RCVD_IN_MSPIKE_WL,URIBL_SBL_A autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 11921 invoked from network); 16 Jan 2021 03:03:45 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 16 Jan 2021 03:03:45 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 9E06F2AA95 for ; Fri, 15 Jan 2021 22:03:43 -0500 (EST) (envelope-from bounce.mMeeebf6e95b6234082af60b40.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 9A8F4120AF20; Fri, 15 Jan 2021 22:03:43 -0500 (EST) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=iitbombay-org.20150623.gappssmtp.com header.i=@iitbombay-org.20150623.gappssmtp.com header.b=KvdI8+CR header.a=rsa-sha256 header.s=20150623 x-bits=2048; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=iitbombay.org; spf=pass smtp.mailfrom=bakul@iitbombay.org smtp.helo=mail-pf1-f180.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:subject:date :references:to:in-reply-to:message-id:list-help:list-id :list-post:list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1610766223; bh=i3PhdfZROemitoKW w6JiylwFNHE0FlXN8as/7AOgWYc=; b=Q7Dw4ezu0WZAyAHmM4xcjAxJ+vMTTCRh 2V1aQSmvhjpvlUUw0uczUpxLkQxrE23WT9EXFDKvp81xR2o04K3yYPpd4fRDFXGs klzBIXTXD4VQOSeXecCOKj6w3E5lVjzk+VVTw/A/HniJqsPdGMd8kPnwBfjx00i6 zhKIuOTxXUw= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1610766223; b=FFPFzpby2R6NOIqbLQCAM1oZqMUbPEnNg8F+ejmUSq6DcrESVc 9+57xPcZ0EpGQVKrlfqALcZuRO3Ww8FjIXhs2yYnIwYOItxLKq8BCtZp36RD+RcK hA8+VY9ckCzCIrzL6jCn5P6iTmS9M5ns/vomAnJU2AhSG26XcOIXEAJHQ= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=iitbombay-org.20150623.gappssmtp.com header.i=@iitbombay-org.20150623.gappssmtp.com header.b=KvdI8+CR header.a=rsa-sha256 header.s=20150623 x-bits=2048; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=iitbombay.org; spf=pass smtp.mailfrom=bakul@iitbombay.org smtp.helo=mail-pf1-f180.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (2048-bit rsa key sha256) header.d=iitbombay-org.20150623.gappssmtp.com header.i=@iitbombay-org.20150623.gappssmtp.com header.b=KvdI8+CR header.a=rsa-sha256 header.s=20150623 x-bits=2048; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=iitbombay.org; iprev=pass smtp.remote-ip=209.85.210.180 (mail-pf1-f180.google.com); spf=pass smtp.mailfrom=bakul@iitbombay.org smtp.helo=mail-pf1-f180.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=ZKoD6zpo; x-ptr=pass smtp.helo=mail-pf1-f180.google.com policy.ptr=mail-pf1-f180.google.com; x-return-mx=pass header.domain=iitbombay.org policy.is_org=yes (MX Records found: alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,aspmx.l.google.com,alt4.aspmx.l.google.com,alt3.aspmx.l.google.com); x-return-mx=pass smtp.domain=iitbombay.org policy.is_org=yes (MX Records found: alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,aspmx.l.google.com,alt4.aspmx.l.google.com,alt3.aspmx.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h=from :content-type:mime-version:subject:date:references:to :in-reply-to:message-id:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=dkim-1; bh=hyesnbyngf/hf/smHhSuvkpMYhgO/v+w XLX/+CfnX8s=; b=owixR+4D7IasIl0cqMVkgrfaY64fDxbY03y69ukKolV0GrX1 4JUOdnhtaOI0FMiw4pwMBN/eBMWSuUggHLoL6nA5p+l/RKVe2+6+J7yA/8FyiKkC SQjBSjCnhaNzc3cLjMC/BlM2TTfSIVjqSmwLliTzfTjvER3os2soTfUR7H8= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id CE358120AB70 for <9fans@9fans.net>; Fri, 15 Jan 2021 22:03:34 -0500 (EST) (envelope-from bakul@iitbombay.org) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 764AB0C1A7E; Fri, 15 Jan 2021 22:03:34 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1610766214; b=FjpJymwBR3unzC6ClXrH1ik1gXbUPKK4hOYmb/OQu3e8tBl7O7 /Nr+FuOQdB8xIY8e+nWEIStfc4zedNX3MzJEc+q2bEbOahACOkiWIzrvI4YORGkG FBVGT5O48zF3haV8Zqn1rsKY+2L8MYzOctCpxP19TsXdWLOsgnpQiVMzIdRD5WhM rxnJYKSQhaUN2olzaX3r7mPuhYwwiFmzU70cCP0sBH4+EXAM9760hFCi6tl6ZeGa 0nvpv5OTwH5VNTwfsJuGC3i0OW5V0tl/AQr4Nw1v3RMIHm/6sczTtfqv7coMshEV cQSdsks75vD0d8FCDKvvHH8Tk+rO+iH4ybWA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=from:content-type:mime-version:subject:date :references:to:in-reply-to:message-id; s=arcseal; t=1610766214; bh=HqG9vxQR41o5MuVPc9Wr2QqhR35Y0qGl/Y3iw9J8r6g=; b=jryzn/HKPiU8 Pp7eb8ev2U3D9kUE1S+Oy7c56atwOuSU1zENuHdZ+hTeMKlfcWwGifZb/QU8ubYc CZGKBMd/CBjtN8+6nf6laeBvwGH0EbpHRtxt6QyWxPoiTTOTS7xWYMDrWoPpBT1C w/8ZdRBt65o3JL+aYUPOT73LCYLgkIDyOkueiDtPhn5EqeVrM1t4wQIlTkZurxoY DyBEd+I6lcEhMLq7DqiiMktAaUgU5Xvt3Qm3tS+2kpDkAVWV37DSuPRdqG+2xJ8g i0sRYls11oxDYq5RjKgWfMYHKS144dBJJ6QR1kcPbUqyGAC+OyimlSy4Q1Or3PG/ 7HBO/xYtcw== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=pass (2048-bit rsa key sha256) header.d=iitbombay-org.20150623.gappssmtp.com header.i=@iitbombay-org.20150623.gappssmtp.com header.b=KvdI8+CR header.a=rsa-sha256 header.s=20150623 x-bits=2048; dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=iitbombay.org; iprev=pass smtp.remote-ip=209.85.210.180 (mail-pf1-f180.google.com); spf=pass smtp.mailfrom=bakul@iitbombay.org smtp.helo=mail-pf1-f180.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=ZKoD6zpo; x-ptr=pass smtp.helo=mail-pf1-f180.google.com policy.ptr=mail-pf1-f180.google.com; x-return-mx=pass header.domain=iitbombay.org policy.is_org=yes (MX Records found: alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,aspmx.l.google.com,alt4.aspmx.l.google.com,alt3.aspmx.l.google.com); x-return-mx=pass smtp.domain=iitbombay.org policy.is_org=yes (MX Records found: alt1.aspmx.l.google.com,alt2.aspmx.l.google.com,aspmx.l.google.com,alt4.aspmx.l.google.com,alt3.aspmx.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrtdefgdehfecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdpuffr tefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhephfgtggfuff hfvfgjkffosegrtdhmrehhtdejnecuhfhrohhmpeeurghkuhhlucfuhhgrhhcuoegsrghk uhhlsehiihhtsghomhgsrgihrdhorhhgqeenucggtffrrghtthgvrhhnpefgvedttdethe eiffdtfedvhfegfeefgfdutefghfefteeutdevfeejgeeltdehheenucffohhmrghinhep lehprdhiohdpghhithhhuhgsrdgtohhmpdhtohhpihgtsghogidrtghomhenucfkphepvd dtledrkeehrddvuddtrddukedtpddujedvrdduvdehrdejjedrudeftdenucevlhhushht vghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddutddrudektd dphhgvlhhopehmrghilhdqphhfuddqfhdukedtrdhgohhoghhlvgdrtghomhdpmhgrihhl fhhrohhmpeeosggrkhhulhesihhithgsohhmsggrhidrohhrgheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (iitbombay.org: Sender is authorized to use 'bakul@iitbombay.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="bakul@iitbombay.org"; helo=mail-pf1-f180.google.com; client-ip=209.85.210.180 Received: from mail-pf1-f180.google.com (mail-pf1-f180.google.com [209.85.210.180]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 15 Jan 2021 22:03:34 -0500 (EST) (envelope-from bakul@iitbombay.org) Received: by mail-pf1-f180.google.com with SMTP id h10so6691975pfo.9 for <9fans@9fans.net>; Fri, 15 Jan 2021 19:03:34 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:from:mime-version:subject:date:references:to :in-reply-to:message-id; bh=HqG9vxQR41o5MuVPc9Wr2QqhR35Y0qGl/Y3iw9J8r6g=; b=ZKoD6zpodj4yPiGMJcgePdeg2SQDsTRodflnqhYH4S1lRA3jVK0WvfrIcvSMm1fypD mMvC8m4o6pMDPGprb71HHwjfbKvCU7L3WAfRsecQPvCq3cqj0BvqHDT40FXbldvW7ArB xOaF7a3U/2JQkRInKzFiP7tRvc2ZXK8fDmR1+hkx5ozZ1RAhiLJC5DYjagfoIh/jldlu sE8Vf4qnus+Ls8UheQAj8WWKS19s7rPOeTwGO6UwH3osO6N7PrR4fNqR4W3xtl7WOpS/ 4a3K8s/XMwrRcQNCSvEfXU322pdbsGRoxyT3ZZ8IMgpT4iaK0K55i8ISNaTzSKQwL6ym wSZg== X-Gm-Message-State: AOAM5300dftevaZxONpitX92Snpu8P3iJv3A5XGzB+SYy3Hmuc+GJobn DwdpfQj2k8b1VM0uYtWIYsHQoCTSvxnq6w== X-Google-Smtp-Source: ABdhPJyXS837b7KjKzZqWCtzdFBvSWp0eGr/d2OyZZsHogUWYqUou2JYgf3Fq5JJmoBcngC2JWBkXw== X-Received: by 2002:a65:6116:: with SMTP id z22mr15929808pgu.264.1610766212854; Fri, 15 Jan 2021 19:03:32 -0800 (PST) Received: from [192.168.1.113] (172-125-77-130.lightspeed.sntcca.sbcglobal.net. [172.125.77.130]) by smtp.gmail.com with ESMTPSA id l190sm9171967pfl.205.2021.01.15.19.03.31 for <9fans@9fans.net> (version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128); Fri, 15 Jan 2021 19:03:31 -0800 (PST) From: Bakul Shah Content-Type: multipart/alternative; boundary="Apple-Mail=_E052A5FF-A156-44A5-89FF-EB6073B1E7F2" Mime-Version: 1.0 (Mac OS X Mail 14.0 \(3654.40.0.2.32\)) Subject: Re: [9fans] Plan9 on Raspberry Pi 400? Date: Fri, 15 Jan 2021 19:03:30 -0800 References: <0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@email.amazonses.com> <0100017703434c67-b7a3d36a-2d2d-42ff-85f8-ac39d964354f-000000@email.amazonses.com> <01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@email.amazonses.com> <01000177079d0a2a-975e1bcf-1ca6-40c5-9219-090dd0d6faab-000000@email.amazonses.com> To: 9fans <9fans@9fans.net> In-Reply-To: Message-Id: X-Mailer: Apple Mail (2.3654.40.0.2.32) Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 6ec4c372-57a7-11eb-8653-c4c064751441 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMDE3ODEzMmYzZDJlZDY4OS1NZWVlYmY2ZTk1YjYyMzQwODJhZjYw?= =?UTF-8?B?YjQwPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:Meeebf6e95b6234082af60b40:1:ySLD3iSAdDJyQZ-pMwgAThIYevg-Zr7fHZCgxCV1ivI --Apple-Mail=_E052A5FF-A156-44A5-89FF-EB6073B1E7F2 Content-Transfer-Encoding: quoted-printable Content-Type: text/plain; charset="UTF-8" USB boot is supposed to work on pi400 as well so I thought there would be n= o need for any firmware loading.... > On Jan 15, 2021, at 2:52 PM, Michael Engel wrote: >=20 > I assume loading the firmware via Linux first won't help since a PCIe res= et probably also=20 > resets the USB controller. >=20 > However, I just checked Richard's kernel source and it seems the firmware= loading functionality > is already included, there is a call to >=20 > xhcireset(BUSBNO(hp->tbdf)<<20 | BUSDNO(hp->tbdf)<<15 | BUSFNO(hp-= >tbdf)<<12); >=20 > in http://9p.io/sources/contrib/miller/9/bcm/usbxhci.c >=20 > The comment for xhcireset in http://9p.io/sources/contrib/miller/9/bcm/vc= ore.c confirms this: > /* > * Notify gpu that xhci firmware might need loading. This is for some > * pi4 board versions which are missing the eeprom chip for the vl805, > * requiring its firmware to come from the boot eeprom instead. > */ >=20 > It seems that this source code is more recent than the images for the SD = card and kernel in=20 > http://9p.io/sources/contrib/miller/ - I'll try building a kernel based on the updated sources. >=20 > - Michael >=20 >=20 >> On 15 Jan 2021, at 23:32, Bakul Shah wrote: >>=20 >> Can you netboot Linux followed by netbooting Paln9 and have a working US= B? >>=20 >>> On Jan 15, 2021, at 1:17 PM, Michael Engel wrot= e: >>>=20 >>> Hi, >>>=20 >>> I didn't test Plan 9 on my RPi 400 so far, but I think the reason for t= he USB problems=20 >>> is the following: >>>=20 >>> The Raspberry Pi 400 (along with the Compute Module 4 and the 8 GB RAM = version=20 >>> of the RPI4) uses a new stepping C0 of the BCM2711. This version does n= ot have a=20 >>> dedicated EEPROM for the firmware of the xHCI USB controller and needs = an=20 >>> additional property mailbox call for loading the xHCI firmware after PC= Ie reset.=20 >>>=20 >>> Some code to load the firmware can be found in the circle bare-metal li= brary (l. 88ff): >>> https://github.com/rsta2/circle/blob/Step42.1/lib/usb/xhcidevice.cpp >>>=20 >>> -- Michael >>>=20 >>>=20 >>>> On 15 Jan 2021, at 20:54, Mack Wallace wrote: >>>>=20 >>>> I took that microSD card that has the bootable image without USB and p= ut it into a traditional Pi4. It boots on that without a problem and has mo= use and keyboard. I notices that after the additional CPU cores are detecte= d, that is mentions usb/hub=E2=80=A6 usb/kbd=E2=80=A6. The image when boot= ing on the Pi 400 never provides those messages. >>>>=20 >>>> Regards, >>>>=20 >>>> Mack=20 >>>>=20 >>>>> On Jan 15, 2021, at 1:44 PM, Mack Wallace wr= ote: >>>>>=20 >>>>> Dear Skip, >>>>>=20 >>>>> That pushed the ball forward significantly, but I still have issues. = (But thank you, every little advancement helps.) So with that flag, I was a= ble to get Richard=E2=80=99s port to boot into Glenda=E2=80=99s account (sh= owing acme, faces, stats, etc). However, I do not seem to have any USB; no = mouse; nor keyboard. Stats is moving on the screen, so things are not too l= ocked up. I did try rebooting with an external keyboard and another mouse. = Still nothing. The external keyboard doesn=E2=80=99t respond to anything (n= o caps lock nor num lock.) One mouse is in the USB 2.0 port, another and th= e external keyboard are in the USB 3.0 ports.=20 >>>>>=20 >>>>> on boot, I see the following: >>>>> usbxhci: 0x1106 0x3483 port 600000000 size 0x1000 irq0 >>>>> #u/usb/ep1.0: xhci port 0x0 irq 0 >>>>>=20 >>>>> The line before is #l for the network, >>>>> The line after is the detection of the other three cores. >>>>>=20 >>>>> The changing of the enable_gic=3D1 on the 9front image seemed to have= to effect. >>>>>=20 >>>>> Thanks again! >>>>>=20 >>>>> Mack >>>>>=20 >>>>>=20 >>>>> On Jan 14, 2021, at 8:15 PM, Skip Tavakkolian wrote: >>>>>>=20 >>>>>> I'm using a RPi400 with Richard's port. I'm netbooting without issue= s and up for days. The only issue I had was forgetting to set 'enable_gic= =3D1' as Richard instructed in the sources. Pi4 works ok without it, pi400 = doesn't. >>>>>>=20 >>>>>>=20 >>>>>> On Thu, Jan 14, 2021, 3:39 PM Mack Wallace = wrote: >>>>>> Thank you for the reply Stuart, but no luck. >>>>>>=20 >>>>>> I did download Mr. Miller=E2=80=99s image. It would not boot at all = until I replaced the files that you mention, but the kernel in that image l= ocks up after detecting the fourth core of the CPU. However, from that fail= ure I learned that those files, (start_cd.elf, start4cd.elf, fixup_cd.dat, = fixup4cd.dat) are necessary for the Pi to boot, and that those with the boo= tcode.bin and presumably, but it doesn=E2=80=99t seem to matter whether I u= se bcm2711-rpi-4-b.dtb or bcm2711-rpi-400.dtb - the dtbs are vital to the p= rocess. - and that all those files simply need to be copied into the fat pa= rtition/boot directory. >>>>>>=20 >>>>>> So I burned another image (actually many, trying different SD cards,= and different configurations, older kernels, etc) and replaced all the fil= es I=E2=80=99ve mentioned with the ones from https://github.com/raspberrypi= /firmware/tree/master/boot (hopefully that=E2=80=99s where I should get the= m). My most recent iteration just has the single error repeated: >>>>>>=20 >>>>>> sdhc: read error intr 2008002 stat 1fff0000 >>>>>>=20 >>>>>> This occurs many times. In the middle of these errors is=20 >>>>>>=20 >>>>>> /dev/sdM0: BCM SD Host Controller 02 Version 10 >>>>>>=20 >>>>>> then the error repeats itself over 50 times before printing out the = lines >>>>>> /dev/sdM0/data >>>>>> bootargs is (tcp, tls, il, local!device)[] >>>>>>=20 >>>>>> At no time during this process is the keyboard or mouse responsive. = Though the mouse icon did become visible during the boot process.=20 >>>>>>=20 >>>>>> I am hoping I am wrong, but I am thinking there is some sort of driv= er issue. At the very least, checking what media there is to mount, or read= ing the SD card. And then possibly for other things, but the former could b= e gumming up the works for everything else. >>>>>>=20 >>>>>>=20 >>>>>>> On Jan 14, 2021, at 6:05 PM, Stuart Morrow wrote: >>>>>>>=20 >>>>>>> Try copying the .dtb *and* the start4 and fixup4. >>>>=20 >>>> 9fans / 9fans / see discussions + participants + delivery options Perm= alink >=20 > ------------------------------------------ > 9fans: 9fans > Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M4ea= 16344e3a69dd362d2644c > Delivery options: https://9fans.topicbox.com/groups/9fans/subscription ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-Meeebf= 6e95b6234082af60b40 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --Apple-Mail=_E052A5FF-A156-44A5-89FF-EB6073B1E7F2 Content-Transfer-Encoding: quoted-printable Content-Type: text/html; charset="UTF-8" USB boot is = supposed to work on pi400 as well so I thought there would be no need for a= ny firmware loading....

On Jan 15, 2021, at 2:52 PM, Michae= l Engel <michael.eng= el@ntnu.no> wrote:

I assume lo= ading the firmware via Linux first won't help since a PCIe reset probab= ly also 
resets the USB controller.

However, I just checked Richard's kernel= source and it seems the firmware loading functionality
is already included, there is a = call to

      = ; xhcireset(BUSBNO(hp->tbdf)<<20 | BUSDNO(hp->tbdf)<<= ;15 | BUSFNO(hp->tbdf)<<12);

in http://9p.io/sources/contrib/miller/9/bcm/usbxhci.c

The comment for xhcireset in = http://9p.io/sources/contrib/miller/9/bcm/vcore.c confirms this:
/*
* Notify gpu that xhci firmware might need = loading. This is for some
* pi4 board versions which are missing the eeprom chip for the= vl805,
* req= uiring its firmware to come from the boot eeprom instead.
*/

It seems that this source code is more recent than the images for th= e SD card and kernel in <= /span>
= http://9p.io/sources/contrib/miller/ - I'll try building a kernel based on the up= dated sources.

- Michael


On = 15 Jan 2021, at 23:32, Bakul Shah <bakul@iitbombay.org> wrote:

Can you netboot Linux followed by netbooting Paln9 and have a worki= ng USB?

On Jan 15, 2021, at 1:17 PM, Michael Engel <michael.engel@ntnu.no> wrote:

Hi,

I didn't tes= t Plan 9 on my RPi 400 so far, but I think the reason for the USB problems<= span class=3D"Apple-converted-space"> 
is the f= ollowing:

The Raspberry Pi 400 (along with= the Compute Module 4 and the 8 GB RAM version 
of the RPI4) uses a new stepping C0 = of the BCM2711. This version does not have a 
dedicated EEPROM for the firmware of t= he xHCI USB controller and needs an&n= bsp;
additional property mailbox call for loading th= e xHCI firmware after PCIe reset.&nbs= p;

Some code to load the firmware c= an be found in the circle bare-metal library (l. 88ff):
https://github.com/rsta2/circle/blob/Step42.1/lib/usb/xhcidev= ice.cpp

-- Michael

On 15 J= an 2021, at 20:54, Mack Wallace <mackbw@mapinternet.com> wrote:

I took that microSD card that has the bootable = image without USB and put it into a traditional Pi4. It boots on that witho= ut a problem and has mouse and keyboard. I notices that after the additiona= l CPU cores are detected, that is mentions usb/hub… usb/kbd….=  The image when booting on the Pi 400 never provides those messages.<= br class=3D"" />
Regards,

= Mack 
On Jan 15, 2021, at 1:44= PM, Mack Wallace <mackbw@mapinternet.com> wrote:
Dear Skip,

That pushed the b= all forward significantly, but I still have issues. (But thank you, every l= ittle advancement helps.) So with that flag, I was able to get Richard&rsqu= o;s port to boot into Glenda’s account (showing acme, faces, stats, e= tc). However, I do not seem to have any USB; no mouse; nor keyboard. Stats = is moving on the screen, so things are not too locked up. I did try rebooti= ng with an external keyboard and another mouse. Still nothing. The external= keyboard doesn’t respond to anything (no caps lock nor num lock.) On= e mouse is in the USB 2.0 port, another and the external keyboard are in th= e USB 3.0 ports. 

on boot, I see the following:
usb= xhci: 0x1106 0x3483 port 600000000 size 0x1000 irq0
#u/usb/= ep1.0: xhci port 0x0 irq 0

The line before= is #l for the network,
The line after is the detection of = the other three cores.

The changing of the= enable_gic=3D1 on the 9front image seemed to have to effect.

Thanks again!

Mack


On Jan 14, 2021, at 8:15 PM,= Skip Tavakkolian <skip.tavakkolian@gmail.com> wrote:

I'm using a RPi4= 00 with Richard's port. I'm netbooting without issues and up for da= ys.  The only issue I had was forgetting to set 'enable_gic=3D1= 9; as Richard instructed in the sources. Pi4 works ok without it, pi400 doe= sn't.


On Thu, Jan 14,= 2021, 3:39 PM Mack Wallace <mackbw@mapinternet.com> wrote:
Thank you for the reply Stuart, but no luck.

I did download Mr. Miller’s image. It would not boot at al= l until I replaced the files that you mention, but the kernel in that image= locks up after detecting the fourth core of the CPU. However, from that fa= ilure I learned that those files, (start_cd.elf, start4cd.elf, fixup_cd.dat= , fixup4cd.dat) are necessary for the Pi to boot, and that those with the b= ootcode.bin and presumably, but it doesn’t seem to matter whether I u= se bcm2711-rpi-4-b.dtb or bcm2711-rpi-400.dtb - the dtbs are vital to the p= rocess. - and that all those files simply need to be copied into the fat pa= rtition/boot directory.

So I burned anothe= r image (actually many, trying different SD cards, and different configurat= ions, older kernels, etc) and replaced all the files I’ve mentioned w= ith the ones from https://github.com/raspberrypi/firmware/tree/master/boot = (hopefully that’s where I should get them). My most recent iteration = just has the single error repeated:

sdhc: = read error intr 2008002 stat 1fff0000

This= occurs many times. In the middle of these errors is 

/dev/sdM0: BC= M SD Host Controller 02 Version 10

then th= e error repeats itself over 50 times before printing out the lines
/dev/sdM0/data
bootargs is (tcp, tls, il, local!dev= ice)[]

At no time during this process is t= he keyboard or mouse responsive. Though the mouse icon did become visible d= uring the boot process. <= br class=3D"" />
I am hoping I am wrong, but I am thinking = there is some sort of driver issue. At the very least, checking what media = there is to mount, or reading the SD card. And then possibly for other thin= gs, but the former could be gumming up the works for everything else.


On Jan 14, 2021, at 6:05 PM, Stuart Morrow <morrow.stuart@gmail.c= om> wrote:

Try copying the .dtb *and* t= he start4 and fixup4.

9fans / 9fans / see discussions + participants + deliver= y options Permalink
=
-------------------= -----------------------
= 9fans: 9fans
= Permalink: = https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M4ea16344e3a69dd3= 62d2644c
Deliver= y options: https://9fans.topicbox.com/groups/9fans/s= ubscription

= --Apple-Mail=_E052A5FF-A156-44A5-89FF-EB6073B1E7F2--