From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 5088434F0B97 for <9fans@9fans.net>; Fri, 21 Aug 2020 12:02:40 -0400 (EDT) (envelope-from litestar@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 18AA0DEC662; Fri, 21 Aug 2020 12:02:40 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1598025760; b=fG7Ig6kP9jhFyDvHN57ugMI4T58V7/h9PVAbAZAxcZu+95CLtf Tuh0gEaGiCkQrwSVoQsf6hXZCaS1z7DJ+QRwZtHtS2GyMTL3tP4WiS2zEYDE483+ NzXAvuY+/K1wzTZzstNw8FmKMFSL8Df9o+GTtX5vmgs0IXnD2iIocg9y9JDgyTtx /a/Qev5VuHfLZYkxyZ++P2aQOv692wE6yQfuNph9XYbbtbRoytsWsZr1TqLURlEA 2LmiNAK6nLf6wJRH7pnfBTzfJt55KPNlndi53uhssIxAzvV0ijMEnEox7RI48vey 52dTpz3MpqZmc/vXxP/MBFj85YTwLjzgCtrA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1598025760; bh=FLRk2lQGP9/QajDJL9uExfgjYYzq97evNoDN0kFqdMM=; b=vmQQuX6lKlpc OUPBYFcAhVTUQSnE2Z7ZkpO7slR2EHojQVdrkhxPknemb3/6RlRcQRU15WJh2+XF MpFU9SL+Gd/jnxMaORfOf64lRchAy8iRwjs1yU6NLUc0tPiAIIbFyoHb7XAhPnMQ zPvjE5F7+8K78/ETTQVboIlGeymd1RmDupE1wiCp6j/XDJiF2HX3zN9B23x39meL 5eEV1mmoUdNYTSaKqxE4zMgyrk/3jAEl/nWnlUqZYstebmiaz81Ez9uzwyhvWon+ 5SG5AU27q2eoLUdf6/hG43fvyoh1hwlN36EvLgPSEdYj1bvY0L7j1++kAad1RKK5 5oXwKiNxyA== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=PNI8pYlG header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.219.44 (mail-qv1-f44.google.com); spf=pass smtp.mailfrom=litestar@gmail.com smtp.helo=mail-qv1-f44.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=n6Q4Z7PY; x-ptr=pass smtp.helo=mail-qv1-f44.google.com policy.ptr=mail-qv1-f44.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=PNI8pYlG header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.219.44 (mail-qv1-f44.google.com); spf=pass smtp.mailfrom=litestar@gmail.com smtp.helo=mail-qv1-f44.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=n6Q4Z7PY; x-ptr=pass smtp.helo=mail-qv1-f44.google.com policy.ptr=mail-qv1-f44.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduiedrudduvddgkeejucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf ffkffuvfgtsegrtderredttdejnecuhfhrohhmpefnihhtvgfuthgrrhcunhhumhhnuhhm shcuoehlihhtvghsthgrrhesghhmrghilhdrtghomheqnecuggftrfgrthhtvghrnhepvd duueekieejgfejjeevuedtfeetleeikeeiuefgleefuefgleegheegleefjeeknecuffho mhgrihhnpehgihhthhhusgdrtghomhdplhhsuhgsrdhorhhgpdhtohhpihgtsghogidrtg homhenucfkphepvddtledrkeehrddvudelrdeggeenucevlhhushhtvghrufhiiigvpedt necurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvdduledrgeegpdhhvghlohepmhgrih hlqdhqvhduqdhfgeegrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpeeolhhithgv shhtrghrsehgmhgrihhlrdgtohhmqecuuffkkgfgpeelgeeige X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'litestar@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="litestar@gmail.com"; helo=mail-qv1-f44.google.com; client-ip=209.85.219.44 Received: from mail-qv1-f44.google.com (mail-qv1-f44.google.com [209.85.219.44]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 21 Aug 2020 12:02:39 -0400 (EDT) (envelope-from litestar@gmail.com) Received: by mail-qv1-f44.google.com with SMTP id cs12so842132qvb.2 for <9fans@9fans.net>; Fri, 21 Aug 2020 09:02:39 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=FLRk2lQGP9/QajDJL9uExfgjYYzq97evNoDN0kFqdMM=; b=PNI8pYlGrhTsCuBPo+PsjF22MYyCyCvbT59Lux6JJ+ihojuN/Oyqg4YaymRPT+oy7W UIM0y9+oD19QgkQY5+ZW3VP30BIXwkPZ8Y7qhvCIsKYz+nBBhazDewAQxOnVjB9mKCV/ jneglh3IhWJZ49KZaVeThB9i/Fzg031AT8ek0kWxBhS30qmSnvmlIYNTIGwHzWUaaGH5 P7jAdTUQKTqo+5G4d+W9TvIXOMPChEFUK5Coyd6Vyk4rukLShott8ARbQ6Rbku+mw+sZ usgmxdQGH+d9E/rjrCYz4o8UHCfBL8+kT+bE8XUncpPLKc418+cC+4v3MeqUbb6qgmAl /Nrg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=FLRk2lQGP9/QajDJL9uExfgjYYzq97evNoDN0kFqdMM=; b=n6Q4Z7PYsY+HM2IrukXa6nfzUcKszYJQMwUdTA5NVGJ3VZKC8v6ccTPpHlOXD7kpnN P4jotJvnP0VhUXsZHb62FDJ9kKa6dNRZsinKBzHFLT0gDbHfVy9778knqVvpNQ+P8QlK 9Ba74QmLTEvOfvR1ULBolS+NaP8slf6xa4ZGBMCOoeNVNmfWgENb4560Bd2H3HeazUpU c+8TyAuTRL876bD+iXlUydAcuQRozAmlKr8ia8gjiHXPZCl+F7d1d8q+l8GHrqmi7osw zLQ/62EzyIJOskAK5xzVxgNhTsrVGHTpSM2XVpLPUS0kZwhBn6212/DtInifJVCGjTvk McnQ== X-Gm-Message-State: AOAM530S3UF1zKYBg+I6sKekJwgPYqRRrH9iQQZPCWoSFEAGqCWBtPVS ZZSpb/EBmv8WB0bLKvvPLUekLvK0/DLp0JDdyyQEB8M4 X-Google-Smtp-Source: ABdhPJx2Pp8RJw4soB9mAtACjM/LxCJWVNUM3ztCkhl0WvdQ+XoJfDQyPz7hUJV5sYMGwS1T4K4CYlOITRKzQipjV6s= X-Received: by 2002:a05:6214:1742:: with SMTP id dc2mr3127273qvb.90.1598025758429; Fri, 21 Aug 2020 09:02:38 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: LiteStar numnums Date: Fri, 21 Aug 2020 12:02:27 -0400 Message-ID: Subject: Re: [9fans] lsub down? To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="000000000000ac588a05ad655dc1" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: c035775a-e3c7-11ea-9b64-bfb62a2c0702 --000000000000ac588a05ad655dc1 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I have that starred, but that's perfect, thank you Rodrigo! On Fri, Aug 21, 2020 at 7:31 AM Rodrigo G. L=C3=B3pez wrote: > github.com/fjballest/clive > > that might be of help while lsub.org is down. > > On Fri, Aug 21, 2020, 1:09 PM LiteStar numnums wrote= : > >> Is lsub down or permanently gone? I was looking for some of the CLive >> papers to show a friend, and the site has sorta disappeared from the >> internet. >> >> -- >> And in the "Only Prolog programmers will find this funny" department: >> >> Q: How many Prolog programmers does it take to change a lightbulb? >> >> A: No. >> -- Ovid >> >> "By cosmic rule, as day yields night, so winter summer, war peace, >> plenty famine. All things change. Air penetrates the lump of myrrh, unti= l >> the joining bodies die and rise again in smoke called incense." >> >> "Men do not know how that which is drawn in different directions >> harmonises with itself. The harmonious structure of the world depends up= on >> opposite tension like that of the bow and the lyre." >> >> "This universe, which is the same for all, has not been made by any >> god or man, but it always has been, is, and will be an ever-living fire, >> kindling itself by regular measures and going out by regular measures" >> -- Heraclitus >> > *9fans * / 9fans / see discussions > + participants > + delivery options > Permalink > > --=20 And in the "Only Prolog programmers will find this funny" department: Q: How many Prolog programmers does it take to change a lightbulb? A: No. -- Ovid "By cosmic rule, as day yields night, so winter summer, war peace, plenty famine. All things change. Air penetrates the lump of myrrh, until the joining bodies die and rise again in smoke called incense." "Men do not know how that which is drawn in different directions harmonises with itself. The harmonious structure of the world depends upon opposite tension like that of the bow and the lyre." "This universe, which is the same for all, has not been made by any god or man, but it always has been, is, and will be an ever-living fire, kindling itself by regular measures and going out by regular measures" -- Heraclitus --000000000000ac588a05ad655dc1 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
I have that starred, but that's perfect, thank you Rod= rigo!

On Fri, Aug 21, 2020 at 7:31 AM Rodrigo G. L=C3=B3pez <rodrigosloop@gmail.com> wrote:
github.com/fjbal= lest/clive

that might be o= f help while lsub.org is = down.

On Fri, Aug 21, 2020, 1:09 PM LiteStar numnums <litestar@gmail.com> wrote= :
Is lsub down or permanently gone? I was looking for some of the CLive pa= pers to show a friend, and the site has sorta disappeared from the internet= .

--
And in the "= Only Prolog programmers will find this funny" department:

Q: Ho= w many Prolog programmers does it take to change a lightbulb?

A: No.=
=C2=A0 -- Ovid

=C2=A0 =C2=A0 "By cosmic rule, as day yields= night, so winter summer, war peace, plenty famine. All things change. Air = penetrates the lump of myrrh, until the joining bodies die and rise again i= n smoke called incense."

=C2=A0 =C2=A0 "Men do not know ho= w that which is drawn in different directions harmonises with itself. The h= armonious structure of the world depends upon opposite tension like that of= the bow and the lyre."

=C2=A0 =C2=A0 "This universe, whic= h is the same for all, has not been made by any god or man, but it always h= as been, is, and will be an ever-living fire, kindling itself by regular me= asures and going out by regular measures"
=C2=A0-- Heraclitus
=


--
And in the "Only Prolog programmers will fi= nd this funny" department:

Q: How many Prolog programmers does = it take to change a lightbulb?

A: No.
=C2=A0 -- Ovid

=C2= =A0 =C2=A0 "By cosmic rule, as day yields night, so winter summer, war= peace, plenty famine. All things change. Air penetrates the lump of myrrh,= until the joining bodies die and rise again in smoke called incense."=

=C2=A0 =C2=A0 "Men do not know how that which is drawn in diff= erent directions harmonises with itself. The harmonious structure of the wo= rld depends upon opposite tension like that of the bow and the lyre."<= br>
=C2=A0 =C2=A0 "This universe, which is the same for all, has no= t been made by any god or man, but it always has been, is, and will be an e= ver-living fire, kindling itself by regular measures and going out by regul= ar measures"
=C2=A0-- Heraclitus
--000000000000ac588a05ad655dc1--