From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.7 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: from tb-ob0.topicbox.com (tb-ob0.topicbox.com [64.147.108.117]) by inbox.vuxu.org (Postfix) with ESMTP id 7C0F126302 for ; Mon, 13 May 2024 04:17:16 +0200 (CEST) Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 8F8031A2B5 for ; Sun, 12 May 2024 22:17:15 -0400 (EDT) (envelope-from bounce.mMe459c34f6ecb73275ab783df.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 8C90F190D823; Sun, 12 May 2024 22:17:15 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=dptDEkaR header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=clintonclinton@gmail.com smtp.helo=mail-vk1-f179.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1715566635; bh=AvbtzaL7VkWQ/Vpk ZcMWf1vbayQLhlZjR3QoWYhJZ6Y=; b=OmoVsMEg9hK8R9sBQe3bKL0DLlF2Uvzf Q69EGwHRRY6kPeVFj0J44D88oNrmKqyPJ8d/JzFuFKSdnftxqkpNjh7hk0pxjGKt FaYqcONl/qyLWhHdmYT7HUoLh5PU2nOQyKtnw+2s3bjHrgLe0mZ12bFHC/051N26 ez7eM8l+Z4Y= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1715566635; b=YdKY2dcGvSxo4h6eWp9cjJtUd+Z6q22SBcAe8vrtiFSj4zSA8X tp/93XnexY5au6a0qTm6TsVFTP2913X3YzoVFrTXAtM54pN2i+UUCK5QyD/NaXFA ad5wnk4LJi0bO0t+dtLb+UfvhPpCwJCMNS3cAMNOqs6cGXLGLTEV5aOd4= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=dptDEkaR header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=clintonclinton@gmail.com smtp.helo=mail-vk1-f179.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=dptDEkaR header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.179 (mail-vk1-f179.google.com); spf=pass smtp.mailfrom=clintonclinton@gmail.com smtp.helo=mail-vk1-f179.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=ELCOA7bA; x-me-sender=none; x-ptr=pass smtp.helo=mail-vk1-f179.google.com policy.ptr=mail-vk1-f179.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:in-reply-to:references:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1715566635; x=1715653035; bh=JH4zdE34WfHaUse1QCL7wCWx5+zbR+XA 7SD+eAj2ubQ=; b=TF0hL32al+HF9r7uNDN/lmvtHzGWWVhN0jB9eiShMANsmwEj ctTQx1mTy9hor0yMPMKaGoS7ltzZJOSquzCK13ZYQ0uZMG+s9DdGzpsFjVePHgsI D67KcsPZR40YNZZJLQ5m7yWEgCjy4Q+agTBRSK+kSOd38jrXWu5W4m4kF1Q= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 8F3BA190D3F8 for <9fans@9fans.net>; Sun, 12 May 2024 22:17:01 -0400 (EDT) (envelope-from clintonclinton@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 632BB674B10; Sun, 12 May 2024 22:17:01 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1715566621; b=ghms9A9st/94iiwXL5vBLuVPQ6xQNlT3can9+AHWPMdjw6UUP0 eG69MXIySXP9pg2SdYMTdd5Letz2V7lYcoVw+5bpfLAO9pWI1dRQ6ySc3OL10tWV qgrhfzHxxJXBxXj8gfIAXsccGeCxzgrNiT6O6fvNKesFkXztq1xdPbzIkRewqKmc GNchSxkDD5lEP7ebFhaO9HjQ1Ww6Il2CUEqNzP8g2VC5zeC7+SQeLB29tgJAykL1 m79Vmuta0W2AvaSY8+9HzXD8V0fh8IoJUmKmsthyvh0hzJipJ0fWE1gkxJzL0gOB /bJODrPaYRUACom0+G1zhD3+LYFe3Lk/GKOA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type; s=arcseal; t=1715566621; bh=xMR1xVa39IunhwaGvGSpQnyDeQkbQFrZF+d8Xja5VIA=; b=t+1n7+W2K0Ab SP+6Ob3RimvTvNA9XeLxufMcUAAwMhEHP8WLxXYjhIp6UTd8bGih0jJzToLCtRaj /JxhraBK4RmorRokSBmK3eR+5qhcjqiW98IT374G44SqA9bcUOMPSHVpnfh11+G0 um9dkR4WiJsjQF3jC+BHxHU93EIoEvmDg7F+1OQPs8MAB/BNnVCNBhzwxiIH7pIk jz/ZyQW/ZMpQ1hub/0Zu9jBLaerm/Ha51LCcFuDPnwz9XVq8y0k/1AaK5gdJVeJc cpSYEhF3n9L8xz4/YT8meSW82I0L5OYk+mDjrzRoULty7hnUZWIgQ2Dv3ysrANkm xo3GjiCN8A== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=dptDEkaR header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.179 (mail-vk1-f179.google.com); spf=pass smtp.mailfrom=clintonclinton@gmail.com smtp.helo=mail-vk1-f179.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=ELCOA7bA; x-me-sender=none; x-ptr=pass smtp.helo=mail-vk1-f179.google.com policy.ptr=mail-vk1-f179.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvledrvdegfedgheeiucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpegjfhfhff fkuffvtgesrgdtreertddtjeenucfhrhhomheptghlihhnthhonhcuoegtlhhinhhtohhn tghlihhnthhonhesghhmrghilhdrtghomheqnecuggftrfgrthhtvghrnhepieeuheduff fhfedvteetueejkeeuhfffjeekhffhueetkefhgefgffegleejfefhnecuffhomhgrihhn pehtohhpihgtsghogidrtghomhenucfkphepvddtledrkeehrddvvddurddujeelnecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvvddu rddujeelpdhhvghlohepmhgrihhlqdhvkhduqdhfudejledrghhoohhglhgvrdgtohhmpd hmrghilhhfrhhomhepoegtlhhinhhtohhntghlihhnthhonhesghhmrghilhdrtghomheq pdhnsggprhgtphhtthhopedupdhrtghpthhtohepoeelfhgrnhhsseelfhgrnhhsrdhnvg htqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'clintonclinton@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="clintonclinton@gmail.com"; helo=mail-vk1-f179.google.com; client-ip=209.85.221.179 Received: from mail-vk1-f179.google.com (mail-vk1-f179.google.com [209.85.221.179]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sun, 12 May 2024 22:17:00 -0400 (EDT) (envelope-from clintonclinton@gmail.com) Received: by mail-vk1-f179.google.com with SMTP id 71dfb90a1353d-4df2fcafc19so1190294e0c.0 for <9fans@9fans.net>; Sun, 12 May 2024 19:17:00 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1715566620; x=1716171420; h=to:subject:message-id:date:from:references:in-reply-to:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=xMR1xVa39IunhwaGvGSpQnyDeQkbQFrZF+d8Xja5VIA=; b=ELCOA7bAp3Zuad/jeHo/HIzUrYDfHp/pATT5axCGxmCuHQdDNGydpoeJ6bkq9Vh57P ZGkdQwNV/8XzGwa4un9zZMyagXBIz1mkyzDxFstq8weAt2NiodLjaMgofEX43GPYX0SF hrkkixZMP0diYoulyVaivV67znmQD0wF8slNuLGnG5COPS+DVzBzeJE4QVFdsZy8Mefi 0fkqWNEs0UMkTu+1GNbjnVqy6jAFdwjHTVaU4P0jcbrriDAiDI3mE2Juurg9412kX0F6 vbhG/2S1R83ZhSAFiGtcZtZDk2dLx0uK9w4ZXEQv+RS77KhCjdoM2kcyOP92eKC86oYJ xXPA== X-Gm-Message-State: AOJu0YygOxSDx3fpVdT1B97Mmobv+Ro54kO/nD6iBqjr7Yb9vCB7qke2 Pyh2kOs7SkbmIVwj4IiTSeimdIYKbckVuUBU7Ffw/7X8LgbMTOog5r4NDuubyeEWZAJ9ZKW2OaN X+isN4SV+oO3YqOFSw8oiQAPGrx5dyg== X-Google-Smtp-Source: AGHT+IEqhuA4P//T3b5fr5Bc/PJ/2a2Dbxl97BeoAm8mL0yQ8EjljPeLh3i53of14blOYYa9s8bKSkfzDqfaHex/Ww4= X-Received: by 2002:a05:6122:1786:b0:4d8:7222:b6da with SMTP id 71dfb90a1353d-4df882c2a3dmr6634452e0c.6.1715566619947; Sun, 12 May 2024 19:16:59 -0700 (PDT) MIME-Version: 1.0 Received: by 2002:a59:1d15:0:b0:464:8670:f713 with HTTP; Sun, 12 May 2024 19:16:59 -0700 (PDT) In-Reply-To: References: From: clinton Date: Mon, 13 May 2024 11:46:59 +0930 Message-ID: Subject: Re: [9fans] Balancing Progress and Accessibility in the Plan 9 Community. (Was: [9fans] Interoperating between 9legacy and 9front) To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary=000000000000f878b506184c7a31 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: e55b12aa-10ce-11ef-a954-a7a7726d99e3 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UY2YxMjhmYTk1NWI4YWFmYy1NZTQ1OWMzNGY2ZWNiNzMyNzVhYjc4?= =?UTF-8?B?M2RmPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:Me459c34f6ecb73275ab783df:1:0oF-GV96VWmMvjsQWwWfkiBCynY6SkQEYTTYKQHoZ8I --000000000000f878b506184c7a31 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable As a very long time lurker to the plan9 mailing list, something occasionally catches my eye strewn amongst the arcana. The very first computer I ever actually touched was in 1979, it had these state of the ark mag stripe cardboard cards which held the enormous amount of 2kb. It wasn't mine, my engineer father brought it home from work and it took up a large proportion of the dining room table. I was very strictly punished for laying a finger on the thing, as it was astronomically expensive and my father was responsible for it. This was just the start of my masochistic relationship with these fiddly cantankerous things you see. Over the years I have seen a $5,500 486dx 2 66mHz be reduced to a $25 pile of junk less than a decade later, a $200 60gb hard drive forlornly sitting by the side of the road in hard rubbish a decade later, and many other similar saddening examples. There of course is a need for using old hardware these days as it seems so wasteful to just junk something with a 1gHz CPU in it when you fondly remember your days with a MOS 6510! If I were completely naive to actually running plan9 but with many clues about other operating systems and hardware, would it be better for me to install 9legacy on some mildly obsolescent but still quite serviceable and reliable hardware, or start with 9front on something more modern? Is the learning curve the same for both varieties? Would it help getting to know 9front if I spent a bit of time with her older sister 9legacy? Can 9legacy be considered the gateway drug to 9front? I await the scorching flames for my great impudence of interjecting into a vociferous discussion with such a pragmatic tangent! On Monday, May 13, 2024, wrote: > I don't think this approach has ever worked in > the open source world -- it always starts with > someone building something useful. The vision > and goal is defined by the work being done. > > After something useful is built, people start > to join in and contribute. > > After enough people join in, it makes sense to > have more organization. > > Quoth vester.thacker@fastmail.fm: > > The complexity of communication in this medium often necessitates > detailed discussions. You highlighted the need for additional personnel = to > manage the workload (e.g. do the work). From my perspective, this requir= es > a well-defined vision, clear objectives, and a prioritized list of > deliverables to align efforts effectively. Currently, it seems the role = of > product managers is collectively held, though it's unclear who exactly is > responsible. Typically, a team of two or more individuals would focus on > these deliverables. In past projects, I've seen the use of a project boa= rd > to keep everyone updated on tasks=E2=80=94an approach known as "informati= on > radiator" in project management. I'm open to other methods if you had > something different in mind that I may have overlooked. If you are > considering a meritocracy, I would recommend caution. Experience has sho= wn > that what we truly need is increased collaboration and unity, rather than= a > system that could potentially encourage competition and division. I > apologize if my message is obtuse, I am trying to keep this message > concise, I can expound more for clarity. I hope my explanation helps. > > > > Vic > > > > > > On Mon, May 13, 2024, at 03:36, ori@eigenstate.org wrote: > > > that's not what I said. > > > > > > Quoth vic.thacker@fastmail.fm: > > >> I agree that having a clear vision and charter is essential before > forming a team. Regarding building an inclusive Plan 9 community that > encompasses multiple groups, it's important to establish common goals and > values that resonate with all members. What are your thoughts on creating > open channels for dialogue and collaboration? How can we ensure that > everyone feels valued and heard? This approach could foster a more > cooperative and inclusive environment. > > >> > > >> Vic > > >> > > >> > > >> On Sun, May 12, 2024, at 16:19, plan6@room3420.net wrote: > > >> > "tl;dr: you need people doing the work before you can try > > >> > to organize them; the way to get people doing the work is > > >> > to bootstrap it by doing work and showing value." [from Ori]. > > >> > or > > >> > "Don't be the kid who can't play [whatever]ball but wants to teach > > >> > everybody and be the team coach, just because he read a book." ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/Tcf128fa955b8aafc-Me459c= 34f6ecb73275ab783df Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --000000000000f878b506184c7a31 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable As a very long time lurker to the plan9 mailing list, something= occasionally catches my eye strewn amongst the arcana. The very first comp= uter I ever actually touched was in 1979, it had these state of the ark mag= stripe cardboard cards which held the enormous amount of 2kb. It wasn'= t mine, my engineer father brought it home from work and it took up a large= proportion of the dining room table. I was very strictly punished for layi= ng a finger on the thing, as it was astronomically expensive and my father = was responsible for it. This was just the start of my masochistic relations= hip with these fiddly cantankerous things you see.
Over the years I hav= e seen a $5,500 486dx 2 66mHz be reduced to a $25 pile of junk less than a = decade later, a $200 60gb hard drive forlornly sitting by the side of the r= oad in hard rubbish a decade later, and many other similar saddening exampl= es.
There of course is a need for using old hardware these days a= s it seems so wasteful to just junk something with a 1gHz CPU in it when yo= u fondly remember your days with a MOS 6510!
If I were completely= naive to actually  running plan9 but with many clues about other oper= ating systems and hardware, would it be better for me to install 9legacy on= some mildly obsolescent but still quite serviceable and reliable hardware,= or start with 9front on something more modern? Is the learning curve the s= ame for both varieties? Would it help getting to know 9front if I spent a b= it of time with her older sister 9legacy? Can 9legacy be considered the gat= eway drug to 9front? 
I await the scorching flames for my gr= eat impudence of interjecting into a vociferous discussion with such a prag= matic tangent!

On Monday, May 13, 2024, <ori@eigenstate.org> wrote:
I don't think this approach has ever worked in
the open source world -- it always starts with
someone building something useful. The vision
and goal is defined by the work being done.

After something useful is built, people start
to join in and contribute.

After enough people join in, it makes sense to
have more organization.

Quoth vester.thacker@fastmail= .fm:
> The complexity of communication in this medium often necessitates deta= iled discussions.  You highlighted the need for additional personnel t= o manage the workload (e.g. do the work).  From my perspective, this r= equires a well-defined vision, clear objectives, and a prioritized list of = deliverables to align efforts effectively.  Currently, it seems the ro= le of product managers is collectively held, though it's unclear who ex= actly is responsible.  Typically, a team of two or more individuals wo= uld focus on these deliverables.  In past projects, I've seen the = use of a project board to keep everyone updated on tasks—an approach = known as "information radiator" in project management.  I= 9;m open to other methods if you had something different in mind that I may= have overlooked.  If you are considering a meritocracy, I would recom= mend caution.  Experience has shown that what we truly need is increas= ed collaboration and unity, rather than a system that could potentially enc= ourage competition and division.  I apologize if my message is obtuse,= I am trying to keep this message concise, I can expound more for clarity.&= nbsp; I hope my explanation helps.
>
> Vic
>
>
> On Mon, May 13, 2024, at 03:36, = ori@eigenstate.org wrote:
> > that's not what I said.
> >
> > Quoth vic.thacker@fast= mail.fm:
> >> I agree that having a clear vision and charter is essential b= efore forming a team. Regarding building an inclusive Plan 9 community that= encompasses multiple groups, it's important to establish common goals = and values that resonate with all members. What are your thoughts on creati= ng open channels for dialogue and collaboration? How can we ensure that eve= ryone feels valued and heard? This approach could foster a more cooperative= and inclusive environment.
> >>
> >> Vic
> >>
> >>
> >> On Sun, May 12, 2024, at 16:19, plan6@room3420.net wrote:
> >> > "tl;dr: you need people doing the work before you c= an try
> >> > to organize them; the way to get people doing the work i= s
> >> >  to bootstrap it by doing work and showing value.&q= uot; [from Ori].
> >> >  or
> >> >  "Don't be the kid who can't play [wha= tever]ball but wants to teach
> >> > everybody and be the team coach, just because he read a = book."

------------------------------------------
9fans: 9fans
Permalink: https://9fans.topicbox.co= m/groups/9fans/Tcf128fa955b8aafc-M0a94c7102286e462a972= a310
Delivery options: https://9fans.topicbox.com/groups/9fans/su= bscription
= --000000000000f878b506184c7a31--