From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id EDAB52620960 for <9fans@9fans.net>; Sun, 10 May 2020 14:37:47 -0400 (EDT) (envelope-from jim.manley@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id AC7AD93F4CA; Sun, 10 May 2020 14:37:47 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1589135867; b=Z8lpQ2Afn651Y2xF75gnXf5M1bxGl2mzlaJAL5bIBrCUCB+FOY XN8zoKBtXiYwh1Iud6DhYeBPGLiTSv6+itlLZN0acDdH5GLFiftm4ZXcF/H6LGQu mniX8h1ucjDURPcjRDAudVuJyC4gL/lSK9FoiyraFI1nwdjwgs6Jp+RP/eoOAmLZ vM8KXfkwKHDSDS9+Wui3Xq2Pd3kOR4OcZ2xiuJcSDcNt9yh6GZEJivZTox2IlSQn sSEYGc6YE6lhsiM+61BxMej2kKiSGIlCaCXbMvCeLL3Yq7Q6nVDJAp4W6NGmQQ5K FE6F5RreEvf6L5Eq4BwwvhAbk5eBv2DBFxLA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1589135867; bh=/KlfVJJTfUo0MEr3GzPYOOsv0M4kDU+m+YqwqwVoBlY=; b=YFMIxE6SOLiI U4tbWgi0ZzRjIgTYkYxsXH5Eb4IRmFkPMEaN2s9NX/J79OC+5Io5bmmFlrpT9k3S vWXLR30HZNEcXT0tA9eFzltSvWFJYpu8Tmx/+u4ZoMPzNXEpLnsLfyaHkP2SYJc8 v4pZ6pLjYhGwfC7kOqpKO/Nx4j4Hkz08rofTeiAy7ydvCA3g7QuNWTrFTQjuCZGl 3lyOHoyVbF6Eja9NROPmFbHgzDsMKH1TD3hmB3PeQO3pldw8tVrC7y2fY99Jogfd PTC/mZF/9otAryFM1QAbuVZGu74v6sUoOjNe55zHNPyEKeVmmpT7W4G5S5LEuNOY KTfXXFY+EQ== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=jIP8EE+x header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.208.171 (mail-lj1-f171.google.com); spf=pass smtp.mailfrom=jim.manley@gmail.com smtp.helo=mail-lj1-f171.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=hW6MBgj9; x-ptr=pass smtp.helo=mail-lj1-f171.google.com policy.ptr=mail-lj1-f171.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=jIP8EE+x header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.208.171 (mail-lj1-f171.google.com); spf=pass smtp.mailfrom=jim.manley@gmail.com smtp.helo=mail-lj1-f171.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=hW6MBgj9; x-ptr=pass smtp.helo=mail-lj1-f171.google.com policy.ptr=mail-lj1-f171.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduhedrkeehucetufdoteggodetrfdotffvucfrrh hofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfurfetoffk rfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhfffkffuvf gtsegrtderredttdejnecuhfhrohhmpeflihhmucforghnlhgvhicuoehjihhmrdhmrghn lhgvhiesghhmrghilhdrtghomheqnecuggftrfgrthhtvghrnhepieffueetheehjedtvd fgudekudehkefgieelleefueeivedtgeelhedujeehvdevnecuffhomhgrihhnpehsrhdr hhhtpdhtfihithhtvghrrdgtohhmpdhgihhthhhusgdrtghomhdpthhophhitggsohigrd gtohhmnecukfhppedvtdelrdekhedrvddtkedrudejudenucevlhhushhtvghrufhiiigv pedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddtkedrudejuddphhgvlhhope hmrghilhdqlhhjuddqfhdujedurdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpeeo jhhimhdrmhgrnhhlvgihsehgmhgrihhlrdgtohhmqecuuffkkgfgpedutdekieej X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'jim.manley@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="jim.manley@gmail.com"; helo=mail-lj1-f171.google.com; client-ip=209.85.208.171 Received: from mail-lj1-f171.google.com (mail-lj1-f171.google.com [209.85.208.171]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sun, 10 May 2020 14:37:47 -0400 (EDT) (envelope-from jim.manley@gmail.com) Received: by mail-lj1-f171.google.com with SMTP id l19so7090904lje.10 for <9fans@9fans.net>; Sun, 10 May 2020 11:37:47 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=/KlfVJJTfUo0MEr3GzPYOOsv0M4kDU+m+YqwqwVoBlY=; b=jIP8EE+x0SbwysyN3MDNmxflX2pshr1IpOyAio6gkRTgJVUJa65ICedxYe35jrcvyF EfDupL/jc+tnv0QjRFLOC/mUECjA40qsjF2D0MuzcjpmX/dOosc+Biskrn0U8F+WoI8T dGRBQ63GvBmLaTDdpoKGIQnS1WZkL11AjfoT0sYEYyxxPUhOMArN84O4sIhpaMPc8yHq 6OTEC+Jipo/WtnvrAf6dy0LVSTuEHvUb2o7JkXMkPhOUcPJNTlQZ2r41jbwK1xhw/qSk Dw1cT02pHR7gAjhw19w8lbQRr2SVrUkYqbjHXbXaDmzCALYgzkiBiolQnqKIuaoo5f54 S9Jg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=/KlfVJJTfUo0MEr3GzPYOOsv0M4kDU+m+YqwqwVoBlY=; b=hW6MBgj9G4mTxICLmOSrEO3h+G1Yr706p6NYahDzzgqvrDWU+ODQQ/yQ+O0CtbkUn5 js4QN54BNUEklhziK2LIe+LQSv9+MWmjoOm/yefncbAUO5CuWFeaUPw7PB3RVaz/k7eV NgM65NwnaVDFJu07qjE11eXG1fNvLsovxUPYM9nRbshDd7M+lSqieB79/3quz+KJVbvE XAZPfruDcrBFdydR+k6n/HuR3rhIK6VFh9HjNvgmrE1XvjQZ/RXJquo6+Xjtq50TMKRt tq6GkUIGBsvdPiQsGIgtZIUr1ZhzvVIygD39j+6zh5A4rOtmGyPx3NG3p3TCTZ7uZbK5 sQDg== X-Gm-Message-State: AOAM533UTjL8APHAV8P47na8CoYqsk5XmUMwFAIYprwfYykfS6qKXem3 pBMHj2LyxqgsLuroHrWy4RZSV78l9fltsXK8CEDnLDhk X-Google-Smtp-Source: ABdhPJzqV9IL6Z0ZqiokhWqyG5qTjlQifZ1/0Ch61FgKe37LQxVh4ZXaKB6xlOoaTJj0yvYfS53MjZ6U5BZpZE5g1ys= X-Received: by 2002:a2e:8901:: with SMTP id d1mr7993406lji.37.1589135865590; Sun, 10 May 2020 11:37:45 -0700 (PDT) MIME-Version: 1.0 References: In-Reply-To: From: Jim Manley Date: Sun, 10 May 2020 12:37:09 -0600 Message-ID: Subject: Re: [9fans] Software preservation in the post-hg era To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="000000000000c4bfee05a54f86c8" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 5b4750c8-92ed-11ea-a0ae-d1dfbd2e8394 --000000000000c4bfee05a54f86c8 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I don't know if he's on here, but Al Kossow (aek at bitsavers dot org), the Software Curator at the Computer History Museum in Mountain View, CA (SillyCon Valley, just down the road from the Googleplex) might be interested in this, if he isn't already aware of what's going on. He's an expert on The Good Fight Against Bit-Rot and has tools for preserving pretty much everything in Original Flavor media formats, as well as on-line= . In addition to the software library collection, the museum also has a separate library dedicated to preservation of the all-important documentation which, if lost, often results in the loss of much of the ability to comprehend the functionality of, let alone maintain, executables and associated data. On Mon, Mar 30, 2020 at 7:12 PM Sean Hinchee wrote: > In the wake of Bitbucket removing hg (Mercurial) support [1], I feel > it's topical to bring up software preservation for the plan9 > community. > > A lot of community contributed software has been put up on Bitbucket > or other hg hosts over time (RIP Google Code), but no consolidated > effort, to my knowledge, seems to have been made to index, let alone > mirror, this software. > > For now, as a stop-gap, I've made a GitHub organization in which I've > consolidated most of what I had indexed from Bitbucket and a few other > places. > > Thanks to people like Ori Bernstein, we have a native git client for > plan9 [3]; without a native client, this kind of transition wouldn't > be nearly as simple, thank you. > > I'm more than happy to add anyone interested in the curation of this > archive to the GitHub organization. It would be nice to have spare > hands around to add README's, mkfiles, and attributions where they > have been missed or never existed. > > In the long term, it would be nice to have a federated or otherwise > decentralized solution to pooling community contributed software, > especially keeping in mind ease of mirroring and picking up old > projects as contributors come and go. > > The contrib/ directory on sources and 9front are fine and good, but > they are centralized. I don't have a proposed solution to this > problem, but it would be nice to have ideas or insight posted =E2=98=BA. > > I recognize that GitHub is also centralized and doesn't solve the > centralization problem, but at least git is really straightforward to > mirror with multiple remotes, etc. and having an index/archive is > valuable at least to me. > > If anyone has further thoughts, anything they want added, or any lists > or indices of works they want archived/mirrored, I would love to see > these posted. > > If anyone wants to mirror the archive, that would be wonderful. I was > considering mirroring everything to a remote in sr.ht in the future, > but haven't gotten around to it. > > As a footnote, there's a decent git client written in Go that works > alright on plan9 [4], but it's slow and memory intensive at the > moment. > > Cheers, > Sean > > [1] https://twitter.com/traverser/status/1244398479591563265 > [2] https://github.com/Plan9-Archive > [3] https://github.com/oridb/git9 > [4] https://github.com/driusan/dgit > > ------------------------------------------ > 9fans: 9fans > Permalink: > https://9fans.topicbox.com/groups/9fans/T303744e1ec6d2108-Ma1c49d00e7042a= 1a8f6713d2 > Delivery options: https://9fans.topicbox.com/groups/9fans/subscription > --000000000000c4bfee05a54f86c8 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
I don't know if he's on here, but Al Kossow (= aek at bitsavers dot org), the Software Curator at the Computer History Mus= eum in Mountain View, CA (SillyCon Valley, just down the road from the Goog= leplex) might be interested in this, if he isn't already aware of what&= #39;s going on.=C2=A0 He's an expert on The Good Fight Against Bit-Rot = and has tools for preserving pretty much everything in Original Flavor medi= a formats, as well as on-line.

In addition to the = software library collection, the museum also has a separate library dedicat= ed to preservation of the all-important documentation which, if lost, often= results in the loss of much of the ability to comprehend the functionality= of, let alone maintain, executables and associated data.


On = Mon, Mar 30, 2020 at 7:12 PM Sean Hinchee <henesy.dev@gmail.com> wrote:
In the wake of Bitbucket removing hg (Merc= urial) support [1], I feel
it's topical to bring up software preservation for the plan9
community.

A lot of community contributed software has been put up on Bitbucket
or other hg hosts over time (RIP Google Code), but no consolidated
effort, to my knowledge, seems to have been made to index, let alone
mirror, this software.

For now, as a stop-gap, I've made a GitHub organization in which I'= ve
consolidated most of what I had indexed from Bitbucket and a few other
places.

Thanks to people like Ori Bernstein, we have a native git client for
plan9 [3]; without a native client, this kind of transition wouldn't be nearly as simple, thank you.

I'm more than happy to add anyone interested in the curation of this archive to the GitHub organization. It would be nice to have spare
hands around to add README's, mkfiles, and attributions where they
have been missed or never existed.

In the long term, it would be nice to have a federated or otherwise
decentralized solution to pooling community contributed software,
especially keeping in mind ease of mirroring and picking up old
projects as contributors come and go.

The contrib/ directory on sources and 9front are fine and good, but
they are centralized. I don't have a proposed solution to this
problem, but it would be nice to have ideas or insight posted =E2=98=BA.
I recognize that GitHub is also centralized and doesn't solve the
centralization problem, but at least git is really straightforward to
mirror with multiple remotes, etc. and having an index/archive is
valuable at least to me.

If anyone has further thoughts, anything they want added, or any lists
or indices of works they want archived/mirrored, I would love to see
these posted.

If anyone wants to mirror the archive, that would be wonderful. I was
considering mirroring everything to a remote in sr.ht in the future,
but haven't gotten around to it.

As a footnote, there's a decent git client written in Go that works
alright on plan9 [4], but it's slow and memory intensive at the
moment.

Cheers,
Sean

[1] https://twitter.com/traverser/status/124= 4398479591563265
[2] https://github.com/Plan9-Archive
[3] https://github.com/oridb/git9
[4] https://github.com/driusan/dgit

------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/T303744e1ec6d2108-Ma1c49d00e7042a1a8f6713= d2
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription
--000000000000c4bfee05a54f86c8--