From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H4,RCVD_IN_MSPIKE_WL autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 16752 invoked from network); 15 Oct 2021 18:36:44 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 15 Oct 2021 18:36:44 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 35A0B1AA70 for ; Fri, 15 Oct 2021 14:36:43 -0400 (EDT) (envelope-from bounce.mM2f885b9745d7b78c928e5fa6.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 32E78BFC00; Fri, 15 Oct 2021 14:36:43 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=FybEvNDU header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=italian.pepe.32@gmail.com smtp.helo=mail-lf1-f41.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1634323003; bh=Xp7Qhlq0YZYw+mOs rvcoxQBJg0Iad3UmsfyQsA4vtio=; b=qH5DsZJmCgazaT8VxbVR5AxWq5CZFH0n C59TCoBjNSS5KbEncJJV5hn+yuWa2sQgDshJRvC8AbJ5kYvFyBSeM5gOkJWcXEi9 86Ah3ZoS4PSejVv0Oc2BnEwZZidYaFh+/+amCgmNGO+vFHyUru04Eoc5oiyqTUxB 3nxsFvVz6RQ= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1634323003; b=Z/XOM5P9qS0JEPK4oilseT5WkYy52r7QQymoG8ZKCDHcK/Aarp x4trz0lVnib14YJ9di9WzSHk9dNeoHMP8hi1TuEGrCRp3wvRe6OBJjk0UhHkPHqz puzj9YM7GCM8Fofg6b5OEHmYrQNbdx7tff26uCBI8r0J2d9ukcxDfTask= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=FybEvNDU header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=italian.pepe.32@gmail.com smtp.helo=mail-lf1-f41.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=FybEvNDU header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.41 (mail-lf1-f41.google.com); spf=pass smtp.mailfrom=italian.pepe.32@gmail.com smtp.helo=mail-lf1-f41.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=m0oRugzm; x-me-sender=none; x-ptr=pass smtp.helo=mail-lf1-f41.google.com policy.ptr=mail-lf1-f41.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; bh=YxOfaiNgYsLdbEE9y0dstl7/WTrhOJAzpjHEycesL8k=; b=h5qj8wWZ7yDF tPowP31bJCbVKS+gBfcTtUlTpVXlIocZ8R0cR3s7//MhQFZU1hiUgnBZRQbDH0fy h5H6x08mEeEZn+6xWIbXpRLQKKd+l/nMw3uxB70rzYtWGI82NDSyHYWS5F4HlLr0 CLU9KybafVfuIyDN7WdNsPE9qrYo/IE= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id D2EEABF7F6 for <9fans@9fans.net>; Fri, 15 Oct 2021 14:36:31 -0400 (EDT) (envelope-from italian.pepe.32@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 6966568F1BD; Fri, 15 Oct 2021 14:36:31 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1634322991; b=ZN/baGPitITvrpVcAndsdyGQKZhbc33mf7eVzfvGfA4hQkdpLu vOJEzOjxF6gK8nL//fLJWI/hGhUavvGCOtnRzGnqWqbAGSXUcwWzgrhaqn+QQCrm ocEkxQroKDhqFlFShv7j9wR6YtUwnCvFJ3nbDziLiKRjfzP0oFD2fOmcKqh8YZxJ 06YoHCJfIz9rwReO6Vu2D7QIFQ1DMIoM/MbHjSPlCCQIstgy4MDzSHNDdBJlkT6e 5pdsZhgA0P02lHPTEWhgzXBO6Am1bvizplbNNDAix9lIbRaLsBG0oHMGRVz/63XY RxhmxVzEAoui8TEbApTN1N/wI4WQYn8YIChA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1634322991; bh=38jyVONIMS8ZwuFjnfSZaxaD6EPzZugPqrHv8bFUMAY=; b=V95d0//+j1Ac EQGNFqvBA4a0u+lJC1z885IQSgMNCOkNZo+gGHXMd3N7gH61AcqM3/1TV3zDNyDn ZcEeb0q6DdyHjVM1zwplr3jB6FnjaaUNMa04LtC5EABtNEMZ3T+ff4uUFTi9TNCR nUmypsKLzdArKn9FqvXfsqFMZgRQCv/EM5s6DyihpmFlT/+c5LZK7Uj3I2kwnmPj mq0BYgY+16Yt6CVStpZfv2jdBzL7mrv7jlcmtSFHlsT3NFabmVQSO3fUmgnmaFE7 sC7uAtKk3I0siN15YwE2hDc4IRH1jk/JHiQoWl5ms4JdeRwvA0w4kEu0uZcSsgU8 C5IB3WHumw== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=FybEvNDU header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.41 (mail-lf1-f41.google.com); spf=pass smtp.mailfrom=italian.pepe.32@gmail.com smtp.helo=mail-lf1-f41.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=m0oRugzm; x-me-sender=none; x-ptr=pass smtp.helo=mail-lf1-f41.google.com policy.ptr=mail-lf1-f41.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvtddrvddugedguddvgeculddtuddrgeduhedrtd dtmdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggft fghnshhusghstghrihgsvgdpuffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftd dtnecunecujfgurhepgghfjgfhfffkuffvtgesrgdtreertddtjeenucfhrhhomhepjhho shgvphhhuchtuhhrtghouceoihhtrghlihgrnhdrphgvphgvrdefvdesghhmrghilhdrtg homheqnecuggftrfgrthhtvghrnhepleffteefieduuddvgeffiedvhfeftddtgeevkeff uddtkeetveeigfevgeetheejnecuffhomhgrihhnpeguihhstghorhgurdhgghdpthhoph hitggsohigrdgtohhmnecukfhppedvtdelrdekhedrudeijedrgedunecuvehluhhsthgv rhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrdduieejrdeguddphh gvlhhopehmrghilhdqlhhfuddqfheguddrghhoohhglhgvrdgtohhmpdhmrghilhhfrhho mhepoehithgrlhhirghnrdhpvghpvgdrfedvsehgmhgrihhlrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'italian.pepe.32@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="italian.pepe.32@gmail.com"; helo=mail-lf1-f41.google.com; client-ip=209.85.167.41 Received: from mail-lf1-f41.google.com (mail-lf1-f41.google.com [209.85.167.41]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 15 Oct 2021 14:36:31 -0400 (EDT) (envelope-from italian.pepe.32@gmail.com) Received: by mail-lf1-f41.google.com with SMTP id p16so45588610lfa.2 for <9fans@9fans.net>; Fri, 15 Oct 2021 11:36:31 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=38jyVONIMS8ZwuFjnfSZaxaD6EPzZugPqrHv8bFUMAY=; b=m0oRugzmmBs1LnyW+OhtcW5LSO5tNlqZTcydaSp2QeFovf/EhfAPo1fLLmksB1ucbT VZd9BKXEC5ACSw9IVHVlOd7YwY/vQLuVsUImvtZ0DtlMBVJeyMaYb3UHvVoeN3ZLjxgd k2GU3KVkOcW/KRZ/FtFIpgay8O87+fqPC6lYSWzw0a+lyJwu5L35hbCw8qq/VfgZotGO RaXtR0PIg7pyZ9ow1Jkipk2culzGUzTsfmsmjQ3ivuhMuTpOkEKY+kUk5+1YC1YqBlsF fCeWXCQjxUVuFVYdnnRnTlRxT9U7jcW57tmo37Vxqz1aBHEV219BxxZimWTrzWYv6cRj GlRA== X-Gm-Message-State: AOAM530LxOs2a6HmD42SsHQUotOkzifAtXQiH6FQZkEScaW/JlDhhApp UFwssHlwpGgN8qftdtkrhtMOppHWdTRn1n6xPsH1C/jz9vc= X-Google-Smtp-Source: ABdhPJxKukO5xnaizb5OjcOmqspxgdA+5Bvs+DcKew6kSg9/wOwjpFh2tNdcD5EWY2xnmnHVwyZS7HfaiN8GDXr+zr4= X-Received: by 2002:a2e:3c15:: with SMTP id j21mr14334495lja.505.1634322989481; Fri, 15 Oct 2021 11:36:29 -0700 (PDT) MIME-Version: 1.0 References: <9D406E20-A639-4768-925C-3892C15A8086@gmail.com> In-Reply-To: <9D406E20-A639-4768-925C-3892C15A8086@gmail.com> From: joseph turco Date: Fri, 15 Oct 2021 14:36:17 -0400 Message-ID: Subject: Re: [9fans] New to plan9 To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="0000000000003c83ee05ce687975" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: d46b1300-2de6-11ec-81c7-887cc255c368 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UNGU4OTg5ZWU0Mjk1MWZhMC1NMmY4ODViOTc0NWQ3Yjc4YzkyOGU1?= =?UTF-8?B?ZmE2Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M2f885b9745d7b78c928e5fa6:1:XXM1aJT2tmioNVFAYmq7h8B4bg_Odx3z6QglyPv9RpY --0000000000003c83ee05ce687975 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Nice! I'm still understanding how to use the OS. I can't even get on the web as its complaining about DNS servers in abaco (I know mothra is preferred but I'm using bell labs plan 9). I need to understand how I can get two plan 9 systems to talk to each other, and then able to mount the fs system on my standalone RPI. I guess it will come to me in due time. On Fri, Oct 15, 2021, 1:47 PM Michael Misch wrote: > I went all in on my first foray, and set up discrete fs + auth + cpu + > terms, it was fun but wholly unnecessary. Eventually I settled into fs/au= th > on one, and a cpu server on the side with drawterm/terms. This was all > 9front, which has some niceties for networked setups, including cpu > listeners for fs/auth to maintain without needing serial/gui/ssh access. > > On Oct 15, 2021, at 10:31 AM, joseph turco > wrote: > > =EF=BB=BF > Thank you to both of you for the responses. I guess getting deep into the > man pages is how I'll have to go about running things. I'm actually > considering taking the OS off my pi, and loading it onto the desktop I ha= ve > as a CPU/file server. I can get legacy9 to boot on it, I just need to > figure out how to get it to work and connect the pi via TCP. I also have > though of just leaving the running system on my pi, also load it on the o= ld > desktop, and just have both boxes talk to each other. The first idea soun= ds > more fun but I'm unsure. > > On Fri, Oct 15, 2021, 10:09 AM sirjofri > wrote: > >> >> 15.10.2021 15:05:25 Sigrid Solveig Hafl=C3=ADnud=C3=B3ttir : >> >> > A few useful links to get started: >>=20 >> To add more infos for community stuff and more: >>=20 >> (Of course, read as much as possible, the man pages, wiki, fqa, articles, >> papers, .... My notes here are just for you to get a small overview of >> the community.) >>=20 >> In general, you'll notice that the bubble is quite small. You'll see the >> same people hanging around and actually meet with people rather than >> writing as an anonymous person to other anonymous persons. I was active >> for less than a month and people started recognizing me. >>=20 >> Here are places people hang out and discuss stuff: >>=20 >> Mailing lists. There are few of them. The 9fans mailing list (here), I >> won't say anything about it (you are already here). >>=20 >> There's also the 9front mailing list for 9front-specific topics (9front >> is a fork); as well as the inferno mailing list. >>=20 >> For chatting there are multiple channels: >>=20 >> The 9fans discord server [1] if you prefer modern apps. We have a voice >> chat and some channels, as well as a bot. Some of the channels are >> bridged to a matrix channel and (through that) to the ##9fans irc on >> oftc. >>=20 >> The ##9fans oftc (actually multiple channels) channels. >>=20 >> The #cat-v channel on oftc is often used for 9front discussion (and cat-v >> discussion). >>=20 >> 9p.zone (which is also the web page) has its own chat system known as >> gridchat (short: grid). It's a 9p filesystem you can import into your >> system and read-write the files there. There are some very special people >> there who don't usually hang out in the other community channels. >>=20 >> In general you'll meet many people in multiple channels depending on >> their preference. You can ask your questions everywhere and hopefully >> they'll be answered. >>=20 >> Welcome to the community! >>=20 >> sirjofri >>=20 >> --- >> [1] https://discord.gg/AMDKS4wdVR > *9fans * / 9fans / see discussions > + participants > + delivery options > Permalink > > ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T4e8989ee42951fa0-M2f885= b9745d7b78c928e5fa6 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --0000000000003c83ee05ce687975 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Nice! I'm still understanding how to use = the OS. I can't even get on the web as its complaining about DNS server= s in abaco (I know mothra is preferred but I'm using bell labs plan 9).= I need to understand how I can get two plan 9 systems to talk to each othe= r, and then able to mount the fs system on my standalone RPI. I guess it wi= ll come to me in due time. 

On Fri, Oct 15, 2021, 1:47 PM Michael Mis= ch <michaelmisch1985@gmail= .com> wrote:
I went all in on my first foray, and set up discrete fs + auth + cpu += terms, it was fun but wholly unnecessary. Eventually I settled into fs/aut= h on one, and a cpu server on the side with drawterm/terms. This was all 9f= ront, which has some niceties for networked setups, including cpu listeners= for fs/auth to maintain without needing serial/gui/ssh access. 
=

On Oct 15, 2021, at 10:31 = AM, joseph turco <italian.pepe.32@gmail.com> wrote:
<= br />
=
Thank you to both of you for the responses. I guess getti= ng deep into the man pages is how I'll have to go about running things.= I'm actually considering taking the OS off my pi, and loading it onto = the desktop I have as a CPU/file server. I can get legacy9 to boot on it, I= just need to figure out how to get it to work and connect the pi via TCP. = I also have though of just leaving the running system on my pi, also load i= t on the old desktop, and just have both boxes talk to each other. The firs= t idea sounds more fun but I'm unsure. 

On Fri, Oct 15, 2021, 10:= 09 AM sirjofri <sirjofri+ml-9fans@sirjofri.de> wro= te:

15.10.2021 15:05:25 Sigrid Solveig Haflínudóttir <ftrvxmtrx@gmail.com>:

> A few useful links to get started:

To add more infos for community stuff and more:

(Of course, read as much as possible, the man pages, wiki, fqa, articles, <= br /> papers, .... My notes here are just for you to get a small overview of
the community.)

In general, you'll notice that the bubble is quite small. You'll se= e the
same people hanging around and actually meet with people rather than
writing as an anonymous person to other anonymous persons. I was active for less than a month and people started recognizing me.

Here are places people hang out and discuss stuff:

Mailing lists. There are few of them. The 9fans mailing list (here), I
won't say anything about it (you are already here).

There's also the 9front mailing list for 9front-specific topics (9front=
is a fork); as well as the inferno mailing list.

For chatting there are multiple channels:

The 9fans discord server [1] if you prefer modern apps. We have a voice chat and some channels, as well as a bot. Some of the channels are
bridged to a matrix channel and (through that) to the ##9fans irc on
oftc.

The ##9fans oftc (actually multiple channels) channels.

The #cat-v channel on oftc is often used for 9front discussion (and cat-v <= br /> discussion).

9p.zone (which is also the web page) has its own chat system known as
gridchat (short: grid). It's a 9p filesystem you can import into your <= br /> system and read-write the files there. There are some very special people <= br /> there who don't usually hang out in the other community channels.
=
In general you'll meet many people in multiple channels depending on their preference. You can ask your questions everywhere and hopefully
they'll be answered.

Welcome to the community!

sirjofri

---
[1] https://discord.gg/AMDKS4wdVR

------------------------------------------
9fans: 9fans
Permalink: https://9fans.topicbox.com/groups/9fans/T4e8989ee42951fa0-M= d0a2f9d5ec3d343efa3c7360
Delivery options: https://= 9fans.topicbox.com/groups/9fans/subscription
= --0000000000003c83ee05ce687975--