From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: * X-Spam-Status: No, score=1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,HTML_MESSAGE,MAILING_LIST_MULTI, PDS_OTHER_BAD_TLD,RCVD_IN_DNSWL_NONE,RCVD_IN_ZEN_BLOCKED_OPENDNS, URIBL_DBL_BLOCKED_OPENDNS,URIBL_ZEN_BLOCKED_OPENDNS autolearn=no autolearn_force=no version=3.4.4 Received: from txout-a1-smtp.messagingengine.com (txout-a1-smtp.messagingengine.com [103.168.172.224]) by inbox.vuxu.org (Postfix) with ESMTP id 4EBEF2A4E5 for ; Thu, 29 Jan 2026 07:44:45 +0100 (CET) Received: from localhost.localdomain (phl-topicbox-02.internal [10.202.2.220]) by mailtxout.phl.internal (Postfix) with ESMTP id F24611C01B3 for ; Thu, 29 Jan 2026 01:44:44 -0500 (EST) ARC-Authentication-Results: i=3; topicbox.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.217.43; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Lw2ZHNxl header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=mikethe1wheelnut@gmail.com smtp.helo=mail-vs1-f43.google.com; x-internal-arc=fail (as.2.topicbox.com=pass, ams.2.topicbox.com=fail (message has been altered), as.1.google.com=pass, ams.1.google.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=3; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:cc:content-type:list-help:list-id :list-post:list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1769669084; bh=6gy4hLicmqOOpeWD w7ZuHsCqhOu2RKHJQk+puVFWZz0=; b=G8o3MXEzPWoR61rBSa7wYfu5hL37Jo0/ /G1lJ5nF2cUFfBQKbwGIKTAkh2UszA5qISKspYDiipUzuDyXzSfjxrrQaeqqOUSQ 4de7uLt1Ao2O1yokYZDsVWD1i/6Sd3jV5kDUQIp5PxiqHUShCyMIZGng+221EzTe QHqjlo1jAnk= ARC-Seal: i=3; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1769669084; b=qi+BqEpKFB/ernT5rmPOqYhRk9xW7+Zjft9mcOs3odPTcIJBj6 NJOLrN31ee82Eo5YDqQ1VVsjCtbM+f8ppnjb/ioes2GBQKNiJgEXmgAeEmMjUIe3 YxXmPRfH+eE0feHchCe9xBRwmOmPRTd8/rwSpOaTEGvBBMOHHQb6kczfE= Authentication-Results: topicbox.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.217.43; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Lw2ZHNxl header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=mikethe1wheelnut@gmail.com smtp.helo=mail-vs1-f43.google.com; x-internal-arc=fail (as.2.topicbox.com=pass, ams.2.topicbox.com=fail (message has been altered), as.1.google.com=pass, ams.1.google.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: authmilter.topicbox.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.217.43; bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Lw2ZHNxl header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.43 (mail-vs1-f43.google.com); spf=pass smtp.mailfrom=mikethe1wheelnut@gmail.com smtp.helo=mail-vs1-f43.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=QYtDEBzi; x-me-sender=none; x-ptr=pass smtp.helo=mail-vs1-f43.google.com policy.ptr=mail-vs1-f43.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_128_GCM_SHA256 smtp.bits=128/128; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:cc:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1769669084; x=1769755484; bh=ZdU56sC6kb/YLZMnIBgGP/7NrWl3w4i5 MjXYbpndxog=; b=MEg6q7/K4rlAwXwwb2v03IjigSTD3nEXrSRygQNRaekV2I8U nx8v8pI+sK2wjUKVHtNzXdw9zvCFWg9VVHzd9H30thk3VnyoMzXaaHGAE9Dk92sD hon3ypWngHV6xzMGFVzYOyORLB3oSiuBr6mW1PSIgsoBtWW0OEbhTWsvV0o= Received: from authmilter.topicbox.com (unknown [172.17.0.1]) by mx.topicbox.com (Postfix) with ESMTP id 829EF35CC931 for <9fans@9fans.net>; Wed, 28 Jan 2026 20:21:28 -0500 (EST) Received: from mx.topicbox.com (172.17.0.1 [172.17.0.1]) by authmilter.topicbox.com (Authentication Milter) with ESMTP id 67967E2CCFB; Wed, 28 Jan 2026 20:21:28 -0500 ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=arcseal; t= 1769649688; b=l5goFtcV3b6l9N5hyZCPWy7FRv85SKtkWrJpKUxBSgOTbOpAtY mXBG1UnxejvBbD5P++uk4+JDdiOc/XBCcOGus9icGWiuv1k8rvM/fY0bY7bllhAJ q8tbg8K6rfcAkfF9FV57ezvzKrVlSHtFL2q2FYM5w7soT9Yy0S9vomkAg7fwu1u1 iJ6t/HaUbRvgMwd05swB0MX9+7gUtfgEsteECBA+USpK2O/bYchosdCXEivxHf25 iCVyrY912tiaQsUA1Yr+PrYNfaWPZy2cRiY0GEn8lNuxnZimMqOCUb+R7/vLzfxK 6kWwC08TDUQpkjlr48bNBWrWswX/cWEPq28g== ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:cc:content-type; s=arcseal; t=1769649688; bh=m8vJkpfDp+YrJ0KF2yXGUxHwMfejPdfREruG1fw2Qtk=; b=heTIJNvHl3nl svs+kxdY8oMF9P6DVBXypYCxchPY8/jZ9UwYX3F/zuneg2sYiTekNUfx8Qts1sJ7 4RYWPVsS0/KfSPf2YpP89+KOvpwn2iMlM3FKN72PUXfLrGONoFVuPJKGBHudKMBW GPFpfZlxpopuXLjMCJgnO/r8l7PS2IA3GSTHIVeQNcZ6yvNP2tSY8NRcjUVbAMz9 Dp4JJumyrHEeYUj2b3neYcv8YpEqm76/V4DM9UH8uGgNQw2vnaQmkxIzaylokCdb LS6cb60buNahyN3ga3CK8sFcm0VrwzGlqaMnfxHOUvzVKa4+wZ0HhYkaklLwWHTb 1cfT1EZcPw== ARC-Authentication-Results: i=2; authmilter.topicbox.com; arc=pass (as.1.google.com=pass, ams.1.google.com=pass) smtp.remote-ip=209.85.217.43; bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Lw2ZHNxl header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.43 (mail-vs1-f43.google.com); spf=pass smtp.mailfrom=mikethe1wheelnut@gmail.com smtp.helo=mail-vs1-f43.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=QYtDEBzi; x-me-sender=none; x-ptr=pass smtp.helo=mail-vs1-f43.google.com policy.ptr=mail-vs1-f43.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_128_GCM_SHA256 smtp.bits=128/128; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeefgedrtddtgdduieegkeejucetufdoteggodetrf dotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggv pdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfh gjhfffkffuvfevtgesrgdtreertddtjeenucfhrhhomhepofhitghhrggvlhculfgvnhhs vghnuceomhhikhgvthhhvgdufihhvggvlhhnuhhtsehgmhgrihhlrdgtohhmqeenucggtf frrghtthgvrhhnpeekvefhhfeuheeggefhvdegffefteeuffetgeelheetvdefgeeiveeg keduiefhvdenucffohhmrghinhepfhhrrghmvgdrfihorhhkpdhophhtihhonhhsrdguvg hvnecukfhppedvtdelrdekhedrvddujedrgeefnecuvehluhhsthgvrhfuihiivgeptden ucfrrghrrghmpehinhgvthepvddtledrkeehrddvudejrdegfedphhgvlhhopehmrghilh dqvhhsuddqfhegfedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomhepoehmihhkvght hhgvudifhhgvvghlnhhuthesghhmrghilhdrtghomheqpdhnsggprhgtphhtthhopedupd hrtghpthhtohepoeelfhgrnhhsseelfhgrnhhsrdhnvghtqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: 209.85.217.43 is authorized to use 'mikethe1wheelnut@gmail.com' in 'mfrom' identity (mechanism 'ip4:209.85.128.0/17' matched)) receiver=authmilter.topicbox.com; identity=mailfrom; envelope-from="mikethe1wheelnut@gmail.com"; helo=mail-vs1-f43.google.com; client-ip=209.85.217.43 Received: from mail-vs1-f43.google.com (mail-vs1-f43.google.com [209.85.217.43]) (using TLSv1.3 with cipher TLS_AES_128_GCM_SHA256 (128/128 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by mx.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 28 Jan 2026 20:21:28 -0500 (EST) Received: by mail-vs1-f43.google.com with SMTP id ada2fe7eead31-5f5423b0980so194097137.0 for <9fans@9fans.net>; Wed, 28 Jan 2026 17:21:28 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1769649688; cv=none; d=google.com; s=arc-20240605; b=Z5RXH/z0LLBFCE+aG3r16AQKCIpy61E2lQ8r143ObpdLc7dHgv4zSG7UEBFdwBUHmS 8HxGKoyxJ4ocLJqSz/uCa9xLK6OYHwajR+AeTdwXacgeJ5CtnkNoKy6Z3518F5Uo9rFS omdMTZpn8J62QD51qnHjYdhktk4pt4f9l4TIUTg6B265y0z2q+E3o7sK6Q7yVtJb8BIC 7HdVc1p39RjD4hJm553VPAZvrEa5t1TubOMg1zUad75oxdT4LnOLK4YbVsC/XC6hh2Qg 6Y+9kcL2SlwcKLUg0c0Wmil5InwYtMFq6haAZEDMS/03LQ4L/96iavRY6AI1QMmu7DsE arzw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20240605; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:dkim-signature; bh=m8vJkpfDp+YrJ0KF2yXGUxHwMfejPdfREruG1fw2Qtk=; fh=K7ZnpmrfQOMj6496aI+iIfG3Cjuy3n0Frita1aTkt7Y=; b=iZCdkfk0y8g7m28zSPAkQF4bRuTUsdqweXTMDxL9DNnUdW9rqpsYSuqa5hhMddNOLr KmVj4c+BS3aAEULWf7eThgf8HjV/D+/U+0/vHsj5p2bCy9j13eV6BjH8Sbpy88bLdi/R KomiFxMiHluSp1X0kZE87TJiP5efcq9uSLyEIE7xk3i+4JcnHuxxI9DcUk/n3G4F5icd 35+L0SyPOKA/x13jAursJmRgoxYdtwMYS0QuvXswvFONHpeMhFU2xwJsb3/ke6fXMcPR T+U5j5BvmYEhsJoOZ/IShuMSJYEpNgambcURu0/BRGsK13YrQ9kdJ16mjRyBwKbw1pQe LSOg==; darn=9fans.net ARC-Authentication-Results: i=1; mx.google.com; arc=none X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1769649688; x=1770254488; h=cc:to:subject:message-id:date:from:in-reply-to:references :mime-version:x-gm-gg:x-gm-message-state:from:to:cc:subject:date :message-id:reply-to; bh=m8vJkpfDp+YrJ0KF2yXGUxHwMfejPdfREruG1fw2Qtk=; b=QYtDEBziUX/TKeZdfVRv2YtHfH+48uOKvKR2TD9z2ZVLes3xbxH7ZYeHkZM0lJ46kD cIrfhxeQvHlPRZCAHTzEYytuI4p6cJ0kSxmyrQIN10pVvzvbWWZoa0qzXMt3g5FwT3Z7 uCRxxKRpczrSkZWnU4GOoRZFN93ha0kIGtPNbcpVTpizTzljihH8Vq7k2HbsVlwTefGA tzCKmxAzGBMAaDdpaVTe+KWI//RQZ70cnJBTeIjcUTQjPruMboyJgRMnEILOUCi7HPed pakq/J+RuVRGDCV8Y08vxlguRmL+PdrJezg3KhN52sOxwWccPHjG1PgbRow0vvMUJtol 8xtg== X-Gm-Message-State: AOJu0YwCX8UGDomRBtcJEY52PcD0C1tiLQ1EAWEVE4Pi3KOiAhfEbXjn R/9qsqJzLPHYGj9S7J5AeOmyvPDVxGD3JL23AM/4h7Dr5BoTYxekXe6A1eWLbIA5RMOPeswJbAM ow03k9SDL4ynVefRkseKTz0a+j1vUKjA= X-Gm-Gg: AZuq6aJYa9z5b2gzvn7VtnrrFOYH6R+JXXR0aHmXEZjln2Lw14OrG5cn0hCsxRFvLrg tH3DUGtZHTHf/2DW2/d3V0253eXDZVqlEGm+YKHVp6BoRNS9E19NX1u9KuvTJzVip9zaLIU9TjW rOOuaILjLv2KsDOnS97vSAUvk3Sqv8nj3IMjOHb5gFlpHDKVL684GdeMy41B0Js7om5NgcBiVD5 HDjyrUchm8RoJ3ombzJ7f37HZwaRVbtnQOaKBHVaI3+wzBhnRDthT17/9qok/wbI5QNvudsCBk7 ywMnD5nZxzaU0eLKlBmvFHCdQxwYQQeNP4DbX1WPUyOWm68D9IlaaSfDST37Xp/ZgPMAy+TLTSU 7NAqaSQkTlxDH+5xhNBtFqDwODmXvlEY240bv0eVhmYkiUiXpaIXAfzg+rHbrACCTUKg= X-Received: by 2002:a05:6102:548b:b0:5f5:4d9b:bd67 with SMTP id ada2fe7eead31-5f7235e6b23mr2180252137.6.1769649687584; Wed, 28 Jan 2026 17:21:27 -0800 (PST) MIME-Version: 1.0 References: In-Reply-To: From: Michael Jensen Date: Wed, 28 Jan 2026 20:21:17 -0500 X-Gm-Features: AZwV_QiPi4ZhENnTxDb_BM8AxiOJmzmFQI1-BPUmAGy_iwFDeR4OucPiDAeu9NU Message-ID: Subject: Re: [9fans] Re: Time for 9? :-) To: ori@eigenstate.org Cc: 9fans@9fans.net Content-Type: multipart/alternative; boundary=00000000000001620406497cad1f Topicbox-Policy-Reasoning: moderate: sender is a non-member Topicbox-Message-UUID: d72b7312-fcb0-11f0-9da7-c54a67e4e2de Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UNmM0NGI2NGRmNTU5MDE4NC1NOWNhMmZhOTI2NDQ1Yzc2ZjIzYjlk?= =?UTF-8?B?NDQyPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M9ca2fa926445c76f23b9d442:0:_B03lSmH4t4VFY-v9X5IghZLzYjsecDTNueHBGKSGfI --00000000000001620406497cad1f Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable ..4 months and counting.. ..gotta be some kind of record.. On Wed, Jan 28, 2026 at 8:19=E2=80=AFPM Michael Jensen wrote: > Still trying to install it. I've been exploring hardware solutions, have > now moved on to qemu. > > On Wed, Dec 31, 2025 at 9:08=E2=80=AFAM Michael Jensen > wrote: > >> The Computer on which the 3-button mouse doesn't work is the same one I >> already submitted data for. >> >> On Wed, Dec 31, 2025 at 9:07=E2=80=AFAM Michael Jensen < >> mikethe1wheelnut@gmail.com> wrote: >> >>> So, I have got to the point where, in principle, I am willing to learn >>> how to use plan9/9front using a live session. I have tried installing = it >>> to a usb-key and got an error that is probably solvable. I also have >>> another "ssd" coming in in a week or so that might work. The main issu= e is >>> that the 3-button mouse I got does not work. I've known this for a whi= le, >>> at first it didn't bug me overly. Now, facing the plunge, I'm not so s= ure >>> I want to deal with the irritation of hardware that isn't designed for = the >>> os in question. So.. are adopters of this system really supposed to be= up >>> to the level of solving such problems on their own? I'm willing, and >>> indeed enthusiastic, about writing most of my own code, using public co= de >>> as inspiration, but solving mouse-driver issues? I'm already taking >>> criticism for pushing as far as openbsd. >>> >>> On Tue, Dec 30, 2025 at 2:13=E2=80=AFPM Michael Jensen < >>> mikethe1wheelnut@gmail.com> wrote: >>> >>>> I have now tried installing 9legacy. To see if it would work any >>>> better. On the 3 computers I have that are currently working. You mi= ght >>>> be happy to know that it worked less well. >>>> >>>> On Sun, Dec 7, 2025 at 7:04=E2=80=AFPM Michael Jensen < >>>> mikethe1wheelnut@gmail.com> wrote: >>>> >>>>> For the record, I have not yet succeeded, but am still trying, in a >>>>> manner of speaking. Investigating running it in qemu, or using plan9= port. >>>>> A tech friend of mine will probably help eventually, if he doesn't su= cceed, >>>>> he will probably generate info that might help with the diagnosis. >>>>> >>>>> Meanwhile, I am looking into framework laptops, and have now found >>>>> something called the reform. Somebody claims that is what most 9front >>>>> people use? >>>>> >>>>> https://community.frame.work/t/plan9-9front-on-framework/13991/2 >>>>> >>>>> Is there one, framework or reform that is more recommended? >>>>> Strongly? Weekly? For 9front? 9legacy? I ask, not knowing how ofte= n the >>>>> FQA is updated. >>>>> >>>>> On Sun, Nov 30, 2025 at 8:35=E2=80=AFPM Michael Jensen < >>>>> mikethe1wheelnut@gmail.com> wrote: >>>>> >>>>>> ..what? I do not understand. In all the tests I just did, for each >>>>>> computer (I did not test the T420), I did at least one test where the >>>>>> ordinary Sata drive was not there, so the only "memory" that could b= e seen >>>>>> was either the mSata, the boot medium, or ram. >>>>>> >>>>>> Ok, this is very strange.. I am trying again on the T430, which >>>>>> happens to have both the mSata and it's ordinary Sata, (coincidence)= , both >>>>>> register, but it looks like I now have -two- /data options. /dev/sd= E0/data >>>>>> and /dev/sdE2/data. As for your suggestion, I have tried accepting= the >>>>>> default, which is [], or nothing, and.. same thing. Infinite loop. >>>>>> >>>>>> ..repeating the test, with the Sata out, I get the same thing, >>>>>> (infinite loop), except that there is now only one /dev/sdE1/data, w= ith a >>>>>> 1, not 2 or 0. >>>>>> >>>>>> On Sun, Nov 30, 2025 at 6:24=E2=80=AFPM wrote: >>>>>> >>>>>>> Quoth Michael Jensen : >>>>>>> > > Well, I've now done about all I can at this end. As I suddenly >>>>>>> suspected >>>>>>> > > right before the test, connecting an msata drive to the computer >>>>>>> via an >>>>>>> > > msata-sata adaptor didn't work. It still looks like a sata. I >>>>>>> assume. >>>>>>> > > >>>>>>> > > I how have the msata in the T430, and it is at least >>>>>>> recognized. Which >>>>>>> > > shows that at least -something- is working. However, selecting >>>>>>> the boot >>>>>>> > > drive still fails, same as before, asking again and again, an >>>>>>> infinite >>>>>>> > > loop. In theory I could do the same test with the T420, but.. >>>>>>> why would >>>>>>> > > the results be different? >>>>>>> > > >>>>>>> > > I can still try the test with this computer, the 7440. >>>>>>> >>>>>>> Hve you tried *not* selecting the first drive? >>>>>>> >>>>>>> ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T6c44b64df5590184-M9ca2f= a926445c76f23b9d442 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --00000000000001620406497cad1f Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
..4 months and counting.. ..gotta be some kind= of record..

On Wed, Jan 28, 2026 at 8:19 PM = Michael Jensen <mikethe1wh= eelnut@gmail.com> wrote:
Still trying to install it.  I'= ve been exploring hardware solutions, have now moved on to qemu.

On Wed, D= ec 31, 2025 at 9:08 AM Michael Jensen <mikethe1wheelnut@gmail.com> wr= ote:
The Computer on which the 3-button mouse doesn't work is the s= ame one I already submitted data for.

On Wed, Dec 31, 2025 at 9:07 = AM Michael Jensen <mikethe1wheelnut@gmail.com> wrote:
So, I have got to = the point where, in principle, I am willing to learn how to use plan9/9fron= t using a live session.  I have tried installing it to a usb-key and g= ot an error that is probably solvable.  I also have another "ssd&= quot; coming in in a week or so that might work.  The main issue is th= at the 3-button mouse I got does not work.  I've known this for a = while, at first it didn't bug me overly.  Now, facing the plunge, = I'm not so sure I want to deal with the irritation of hardware that isn= 't designed for the os in question.  So.. are adopters of this sys= tem really supposed to be up to the level of solving such problems on their= own?  I'm willing, and indeed enthusiastic, about writing most of= my own code, using public code as inspiration, but solving mouse-driver is= sues?  I'm already taking criticism for pushing as far as openbsd.=

On Tue, Dec 30, 2025 at 2:13 PM Michael Jensen <mikethe1wheelnut@gmail.com= > wrote:
I have now tried installing 9legacy.  To see if it = would work any better.  On the 3 computers I have that are currently w= orking.  You might be happy to know that it worked less well.
On Sun,= Dec 7, 2025 at 7:04 PM Michael Jensen <mikethe1wheelnut@gmail.com> w= rote:
For the record, I have not yet succeeded, but am still trying= , in a manner of speaking.  Investigating running it in qemu, or using= plan9port.  A tech friend of mine will probably help eventually, if h= e doesn't succeed, he will probably generate info that might help with = the diagnosis.

Meanwhile, I am looking into fram= ework laptops, and have now found something called the reform.  Somebo= dy claims that is what most 9front people use?

<= a href=3D"https://community.frame.work/t/plan9-9front-on-framework/13991/2"= target=3D"_blank">https://community.frame.work/t/plan9-9front-on-framework= /13991/2

  Is there one, framework or r= eform that is more recommended?  Strongly?  Weekly?  For 9fr= ont? 9legacy?  I ask, not knowing how often the FQA is updated.
<= /div>
On Sun, Nov 30, 2025 at 8:35 PM Michael Jensen <mikethe1wheelnut@gmail.com<= /a>> wrote:



On Sun, Nov 30, 2025 at 6:24 PM <ori@eigenstate.org> wrote:
Quoth Michael Jensen <mikethe1wheeln= ut@gmail.com>:
>
> > Well, I've now done about all I can at this end.  As I s= uddenly suspected
> > right before the test, connecting an msata drive to the computer = via an
> > msata-sata adaptor didn't work.  It still looks like a s= ata.  I assume.
> >
> > I how have the msata in the T430, and it is at least recognized.&= nbsp; Which
> > shows that at least -something- is working.  However, select= ing the boot
> > drive still fails, same as before, asking again and again, an inf= inite
> > loop.  In theory I could do the same test with the T420, but= .. why would
> > the results be different?
> >
> > I can still try the test with this computer, the 7440.
>

Hve you tried *not* selecting the first drive?

= --00000000000001620406497cad1f--