From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 23914EF644B for <9fans@9fans.net>; Fri, 13 Dec 2019 02:08:45 -0500 (EST) (envelope-from crossd@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 87D23EA0B27; Fri, 13 Dec 2019 02:08:45 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1576220925; b=GBxJM/dSSBD1XzSeEc9uc0U37XGyHBNZ2EyrnKD9cJ+VRO/Zhi QHj6Irx3Gf6h2wjy8SVXkL8SnmnS55T320J3t+EQTGcbZQFrrZjCdQcWoJcXNI8M QDC7NQi7F3F4faQwNgbRv3vjcS9kQshc6q5SWdqTQUeKu/APjT9cJvTqDvHF4fi2 ciwgy9ElQE9mou7WOQoLmGBV/0uOSwC2ioupbX2vwJHj94a4ao+TW88U2VhM3Ums p/+lf8g+nN7/bBmPZdSiqgszGdOi1WGat7NU0SRv1r6fNReIKZk0sEaF8IQANREU sTfuOaT+2qhf/k/j7kovUh4P10ZxkXXAy5cQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1576220925; bh=HbuJF1s5lphyfY8HtnR0Ddr1a+/pCCA/A5+ZSVvgVL4=; b=K/kYsBOBUe66 PtBlBnS4LMAcP5k4SV3JEgFUKyleHnyqPG6YuhGje3H+9aSxI2FgQF0BNNTYUL+h T3vuY/8V14EiJsoQsc+2N/RXAim+Z5CV52LZfPJH1XCct7auRN6Szb4jZDI2OBdV X9FnFamJVDaO9j8eCel/xSVSU4TKSyhKLeTEAR5YFKAlkRbVpTCUPEDIxY+i+Uhb 6zJqL1v7XAY0C+mtx6K0E3D21aPyczZIX1KeLSDtwBvgMCY1Iis7mfKdhekbvTXL Ai0BtlXTzpoKNgLDMyZ7Um7KvlvXLxCghDc+dyJTAgUKS2N3UHHkNKkUBiM7c2Xt EmqU4W0tNg== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Xr//Bx69 header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.219.53 (mail-qv1-f53.google.com); spf=pass smtp.mailfrom=crossd@gmail.com smtp.helo=mail-qv1-f53.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=Gtix4TyT; x-ptr=pass smtp.helo=mail-qv1-f53.google.com policy.ptr=mail-qv1-f53.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Record found); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Record found); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Xr//Bx69 header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.219.53 (mail-qv1-f53.google.com); spf=pass smtp.mailfrom=crossd@gmail.com smtp.helo=mail-qv1-f53.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=Gtix4TyT; x-ptr=pass smtp.helo=mail-qv1-f53.google.com policy.ptr=mail-qv1-f53.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Record found); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Record found); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedufedrudelkedguddtfecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhepgghfjg fhfffkuffvtgesrgdtreertddtjeenucfhrhhomhepffgrnhcuvehrohhsshcuoegtrhho shhsugesghhmrghilhdrtghomheqnecuffhomhgrihhnpehtohhpihgtsghogidrtghomh dprhgvshgvrghrtghhrdhgohhoghhlvgenucfkphepvddtledrkeehrddvudelrdehfeen ucfrrghrrghmpehinhgvthepvddtledrkeehrddvudelrdehfedphhgvlhhopehmrghilh dqqhhvuddqfhehfedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomhepoegtrhhoshhs ugesghhmrghilhdrtghomhequcfukfgkgfepjeekgeehnecuvehluhhsthgvrhfuihiivg eptd X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'crossd@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="crossd@gmail.com"; helo=mail-qv1-f53.google.com; client-ip=209.85.219.53 Received: from mail-qv1-f53.google.com (mail-qv1-f53.google.com [209.85.219.53]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 13 Dec 2019 02:08:44 -0500 (EST) (envelope-from crossd@gmail.com) Received: by mail-qv1-f53.google.com with SMTP id n8so440891qvg.11 for <9fans@9fans.net>; Thu, 12 Dec 2019 23:08:44 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=HbuJF1s5lphyfY8HtnR0Ddr1a+/pCCA/A5+ZSVvgVL4=; b=Xr//Bx69UXQA9Yq3+V08KMQMSeRuiA1dNS7MigmdJDVYTQ+0Fsa7YuUd2076ny0U2/ lreUqX2yOr1gJEaI2Cjk2H+v1I4v/trnXN5pfUbMKot+y6rkRLoR4eCV4YJkti/WK7d0 dKqHz+S2WeLE0Cz7BbzBiy3JwjhVj7GLLRYrrGiaNj3VcDslHf5Aj0eK9l4CwZgOnOW+ tIkzNiOG/kCA4ydCOQTr1T1mgZySkJ274zfgjWksjbBlmhxgkon5DsKe3tFy834DctfG 5znM+GHN8bdPZVyQ1f/SHtrlRUsuFaV4VS3XD5V2YcJbHrY07caV4kfqJRa3mkKl3+Ss RdtA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=HbuJF1s5lphyfY8HtnR0Ddr1a+/pCCA/A5+ZSVvgVL4=; b=Gtix4TyTZWsLFyYt3zxPFM3WQZhfpFn9TaBx3eml1kjyKebGxzn1AjLcsDlQatFLvx y/bodYTfabQN1xT4wkcgP8ZBjSnsdqbJaADZuuzrxIJvtnFFcplENaGICn1XMSe91XwJ Ta54GrA4HSiV3SYe2Djm6HlxBkvKPgeiPeKFm8czKFFzHPZ6OtsjbU2CZlKIt0KJwOql c5oyEsjDK/zLoRLP42sxYbpX9LPRFYu013fXaraqrkHI5GCv+tuihY0ziYAjfSE40Ikn 1cmTHWFPdVHAXPVuvcj7Lhh1jFe3YluAdKpefoUFsLD1vdpDiguYd5ln72Ie0xRLc9n5 RzIA== X-Gm-Message-State: APjAAAWfQfe2DUp8Gnxs/YksG8mS1y6OJY2ZB1rzabEtgQ9EJxkRqOJL wBb9YLVgNuwh8nU6U0GWsQ53QZP52i4FPESGThFk4PGZ X-Google-Smtp-Source: APXvYqwSB2uYkWdWFj2Adhl1roRVaixZ8wA6d3sZUvitNPBCgT4oFnk2YRiGYAqrUku9uesu18udLZGw69afLT8XSuY= X-Received: by 2002:a0c:fac1:: with SMTP id p1mr12362631qvo.231.1576220924054; Thu, 12 Dec 2019 23:08:44 -0800 (PST) MIME-Version: 1.0 References: <644326F9-F36C-407A-9436-7F2F58909810@pobox.com> In-Reply-To: From: Dan Cross Date: Fri, 13 Dec 2019 12:38:32 +0530 Message-ID: Subject: Re: [9fans] ARM hardware and SATA To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="0000000000004412ca05999088a2" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 699dac30-1d77-11ea-b154-d28da8fa675b --0000000000004412ca05999088a2 Content-Type: text/plain; charset="UTF-8" Google invests heavily into basic computer science reseach, and Google researchers are well represented at respected conferences and in high impact journals in their subfields. So yes, one can do 'actual "research" projects' at Google. We have an entire research organization doing just that, often in collaboration with academia: https://research.google/ However, not everyone working on experimental projects at Google is doing what one might call "research". For some, such as myself, the line can be blurry, but I'm firmly in a development camp, as are most people I know. To put it succinctly for me, as for many others, the job isn't to publish papers or present results, it's to write software of value to Google. However, we have considerable latitude to investigate new and innovative ways of writing that software. Of course, that also entails taking lessons learned from systems outside of the mainstream. It's true that Barret still works on Akaros: it was his PhD thesis topic. However, Google is no longer investing in it directly. - Dan C. On Thu, Dec 12, 2019, 8:54 PM hiro <23hiro@gmail.com> wrote: > Dan, does that mean you are allowed to have actual "research" projects > at google? i just never thought something like this would be possible, > and never realized akaros happened at google itself. i imagined the > involvement of universities instead, but i clearly didn't check > closely enough. > I hear only bad news from google lately, but if they give enough > freedom to also do basic research (or let's call it OS development > cause IT research is an oxymoron) that's great news to me indeed :) > And as you said all i know of google is their web site. or knew, cause > many useful services like google code search are no more. at least > google mail still works :P > > ------------------------------------------ > 9fans: 9fans > Permalink: > https://9fans.topicbox.com/groups/9fans/Tfa3a09b0e78ea56b-M83eb9f288fd21e628ab53d6d > Delivery options: https://9fans.topicbox.com/groups/9fans/subscription > --0000000000004412ca05999088a2 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Google invests heavily into basic computer science r= eseach, and Google researchers are well represented at respected conference= s and in high impact journals in their subfields. So yes, one can do 'a= ctual "research" projects' at Google. We have an entire resea= rch organization doing just that, often in collaboration with academia:=C2= =A0https://research.google/
<= div dir=3D"auto">
However, not everyone working = on experimental projects at Google is doing what one might call "resea= rch". For some, such as myself, the line can be blurry, but I'm fi= rmly in a development camp, as are most people I know. To put it succinctly= for me, as for many others, the job isn't to publish papers or present= results, it's to write software of value to Google. However, we have c= onsiderable latitude to investigate new and innovative ways of writing that= software.

Of course, th= at also entails taking lessons learned from systems outside of the mainstre= am.

It's true that B= arret still works on Akaros: it was his PhD thesis topic. However, Google i= s no longer investing in it directly.

=C2=A0 =C2=A0 =C2=A0 =C2=A0 - = Dan C.

On Thu, Dec 12, 2019, 8:54 PM hiro <23hiro@gmail.com> wrote:
Dan, does that mean you are allowed to have actual "rese= arch" projects
at google? i just never thought something like this would be possible,
and never realized akaros happened at google itself. i imagined the
involvement of universities instead, but i clearly didn't check
closely enough.
I hear only bad news from google lately, but if they give enough
freedom to also do basic research (or let's call it OS development
cause IT research is an oxymoron) that's great news to me indeed :)
And as you said all i know of google is their web site. or knew, cause
many useful services like google code search are no more. at least
google mail still works :P

------------------------------------------
9fans: 9fans
Permalink: https://9fans.topicbox.com/groups/9fans/Tfa3a09b0e78ea56b-M83eb9f288fd= 21e628ab53d6d
Delivery options: https://9fans.topic= box.com/groups/9fans/subscription
--0000000000004412ca05999088a2--