From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id C8F17A3270F for <9fans@9fans.net>; Sun, 24 Nov 2019 07:41:06 -0500 (EST) (envelope-from 23hiro@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 415857475BD; Sun, 24 Nov 2019 07:41:06 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1574599266; b=lSChCB/A29xwSEKyspyI8IX3Jj2Ic9y6zg7bKgu6M66spPh9zI UATw1pI6WtFB4C6+L56Z66PPqZVgXrOJO5Fn71xbEpDVxKtW5bRxLvWTMjIZFA4U baYZzzZdFqlOV0+qCKxhz45evGzrICSrJfM1fttpjdiWUTFSWMFXPPv/vPheYKzN r+E63LmxKQfi2Tod7yzLpnrXoL8Vrtwr89nHFPvYV8WA/e/dl/KD7aVFq7s+xloV ow1b5cJO0NbUnhflKphzbKwyEQc2usvvilTAHE0cH/JxpEGwrdSZvDMst5uqK3RQ IA6YikuAXRsOJX2hqlj0rEy9wrVJZyrqvgMQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type; s=arcseal; t=1574599266; bh=FeK5l0/8I9S8+H0+y5ubzEHVoh8721ZjqwJX7ZLS4pA=; b=XHOTtV8c7Ng/ PNAKWEQPOk6X7E779kx/Hspxbu+WLXUAOTHMRj5EwMkfttWSyuzWbHEuc6Y9QP9A LW0Ehw+UTtxXPWHPsWHbi7nXKdmhnn7PyhNHfXELu8MI6mavhGF94lshyOfVz+HW SqhKcaK+jtcMN19vHjv2jWN82aspSqU0iY9PWANUYBTZ13f5ALF6EPSni5tVNVbp yew3y0fLz4HitrSqNIfP3+Lx/NX5eul1UeiDJkA3Xw5XlqWBCQCNogGjlQCpP6v3 lxYfGHVqa8ZK+Xil0D1JS3SbsGjx+rPi6nMiE3ee1UCY/VV31dQoNcf6vJZvr5Y0 0u+/8K2bUQ== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=kRFSIbeN header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.50 (mail-wr1-f50.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-wr1-f50.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=Hl6pP+7k; x-ptr=pass smtp.helo=mail-wr1-f50.google.com policy.ptr=mail-wr1-f50.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Record found); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Record found); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=kRFSIbeN header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.50 (mail-wr1-f50.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-wr1-f50.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=Hl6pP+7k; x-ptr=pass smtp.helo=mail-wr1-f50.google.com policy.ptr=mail-wr1-f50.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Record found); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Record found); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedufedrudehkedggeegucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpegjfhfhff fkuffvtgesthdtredttddtjeenucfhrhhomhephhhirhhouceovdefhhhirhhosehgmhgr ihhlrdgtohhmqeenucffohhmrghinhepthhophhitggsohigrdgtohhmnecukfhppedvtd elrdekhedrvddvuddrhedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddvuddr hedtpdhhvghlohepmhgrihhlqdifrhduqdhfhedtrdhgohhoghhlvgdrtghomhdpmhgrih hlfhhrohhmpeeovdefhhhirhhosehgmhgrihhlrdgtohhmqecuuffkkgfgpeejkeeljeen ucevlhhushhtvghrufhiiigvpedt X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use '23hiro@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="23hiro@gmail.com"; helo=mail-wr1-f50.google.com; client-ip=209.85.221.50 Received: from mail-wr1-f50.google.com (mail-wr1-f50.google.com [209.85.221.50]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sun, 24 Nov 2019 07:41:06 -0500 (EST) (envelope-from 23hiro@gmail.com) Received: by mail-wr1-f50.google.com with SMTP id z7so10717040wrl.13 for <9fans@9fans.net>; Sun, 24 Nov 2019 04:41:06 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:in-reply-to:references:from:date:message-id:subject:to; bh=FeK5l0/8I9S8+H0+y5ubzEHVoh8721ZjqwJX7ZLS4pA=; b=kRFSIbeNgscAxKJ2dCaXk+rG7fEchJdf4uCPhtfJZKic3xdJ71Q/9uT+wS9sfwdKzP XPq9o7aPqpGtGewoxxXBT4ai6Yoc9PJ3NIcIY9x7AslSohRyBmpWf0SeqHsfZazUl/g2 O6Ala/PqMbBNT8iHxn7MVf+57ZjMxDpekrHfqqGX1E2vC61KrlSdoYgbad3ZN6SBSF8d 5FWXu6qnPYf05ezmrJHseUKL6OQKWUZi4AYD89UufQRE5f+PkDtjYZiMucpCjCZtSq8P dPZSG0uetmRTmA+p8aQmPz21Y0D/5hlUJICdTvPM9ApPoFwM6pp839HX/ix/QU9YdSdE FDMQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:in-reply-to:references:from:date :message-id:subject:to; bh=FeK5l0/8I9S8+H0+y5ubzEHVoh8721ZjqwJX7ZLS4pA=; b=Hl6pP+7ku8uWKCWNfnGe4pvv/CPTbGByAMXyoEiliAwwLpIT5fBqUe0ZuHMjBZtn3D W3jjh1HPea6sXMFVg+FD4Ub28FCQb3yCBt/iAKF+SB2KuBF60wh0gUDx5weS1NlWbXeM HI6Ay1AwqMda1+G73maAI2qc8WQ9L7OkfUJJUo0D8GVI0oaxYSOwtdpRQ6MFoUuXd1i6 AdPXZCFeb+0Ns/+U53aL1LwojDgEBYi1NBSZBJ9hldDPvGE0yK5SFfVxYoHvPAZeC2oV t/0iMn0R6eEu071dOFDgwSskzVi6zdEkNaq7xoNmXEpEAiarkE8GR7O9S3ymr3z2mlIe xEkA== X-Gm-Message-State: APjAAAWspifTz520porWrksD+F3X6HtP/Bu5YzmcxhDzt6EUHhZxADbr u20+KtSZt53/n5wtRSmbniFQWVx+zQxLzRLjbnBXZQ== X-Google-Smtp-Source: APXvYqzyJTfCsN5X0LW2R0d23MbRGW9iTXF4wfRXsKHu0yNuhi3M1KbQ7PkGp10S8JKqggHi2euPulDANG/5HcP+9oo= X-Received: by 2002:adf:e5ce:: with SMTP id a14mr5575562wrn.214.1574599264999; Sun, 24 Nov 2019 04:41:04 -0800 (PST) MIME-Version: 1.0 Received: by 2002:adf:f4d1:0:0:0:0:0 with HTTP; Sun, 24 Nov 2019 04:41:03 -0800 (PST) In-Reply-To: <73458d38ba582a30687e811898b41388@hamnavoe.com> References: <20191123150842.0cb241ffef2e3b6b0affa08a@eigenstate.org> <73458d38ba582a30687e811898b41388@hamnavoe.com> From: hiro <23hiro@gmail.com> Date: Sun, 24 Nov 2019 13:41:03 +0100 Message-ID: Subject: Re: [9fans] Is the vanilla Plan 9 still alive? To: 9fans <9fans@9fans.net> Content-Type: text/plain; charset="UTF-8" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: b19850f4-0eb7-11ea-b104-8cd3ec577463 ok, that is undeniably activity. now i'm giving an even more *horrible* metric of activity, to defend our confusion at least slightly. 9front activity during the same period: hg log|sed -n '1,/Mar 18.*2016/p'|grep changeset|wc -l 2282 here i give only the count of commits, and hope somebody will feel motivated to check the actual content instead of me reciting them all here. in the end what matters is what is inside. there have been lots of improvements to plan 9 you can find 9front. 9front contributions in my opinion are far from superficial or cosmetic as the art analogy earlier seemed to suggest. it's not only new drivers, there are also deeper changes, lots of bugfixes, updating, polishing has been done. quality has generally improved a lot - i wonder what gave anybody the opposite impression... it makes me sad to believe that regardless of our cultural differences you cannot see the technical merit of what has been contributed to 9front. how about more people try to actually use the software that has been contributed, so that we together have a chance to at least praise all the guys doing the heavy lifting (not me). apart from miller, i don't feel like most people having this discussion here are at all invested, i.e. contributing any code... thanks for your work, too, richard miller, i finally got a rpi4, and i'm enjoying 4k@60hz native plan9. it's something none of the much more expensive modern intel igpu can even deliver via hdmi :) and the usb is working, and the gigabit ethernet is working. it's phenomenal. i never gave you much thanks before this because i had such awful experiences with rpi hardware that i could not even fathom anybody's investment in such flawed hardware. but now that they have fixed their hardware i can truly make use of your software, too. turns out to be a great choice after all: a niche product/form-factor, but well worth it. and so, thanks again. with enough space to put all the thinkpads and rpi4 and big 4k screen and keyboard and mouse, i hope i will sooner rather than later not only administer, but instead use plan 9 as intended as a development environment and contribute something back. i hope people can relate in the meantime. On 11/24/19, Richard Miller <9fans@hamnavoe.com> wrote: >> The most official looking site for vanilla plan9 is 9p.io. It >> doesn't show any sign of activity since 2015. > > Please look more closely: > > cpu% srv -n 9p.io sources /n/sources > post... > cpu% ls -lrt /n/sources/patch/*/files|tail -24 > --rw-rw-r-- M 2032 fst sys 160 Mar 18 2016 > /n/sources/patch/kexportfs/files > --rw-rw-r-- M 2032 miller sys 102 Apr 19 2016 > /n/sources/patch/segment-overlap/files > --rw-rw-r-- M 2032 miller sys 30 Apr 19 2016 > /n/sources/patch/proc-smp-fixes/files > --rw-rw-r-- M 2032 miller sys 172 Apr 19 2016 > /n/sources/patch/armv7-atomic/files > --rw-rw-r-- M 2032 djc sys 36 Apr 19 2016 > /n/sources/patch/pread-offset/files > --rw-rw-r-- M 2032 fst sys 33 May 22 2016 > /n/sources/patch/dial-await-bug/files > --rw-rw-r-- M 2032 miller sys 38 May 29 2016 > /n/sources/patch/usbserial-ftdi-writelen/files > --rw-rw-r-- M 2032 bootes sys 76 May 29 2016 > /n/sources/patch/usbether-rpi/files > --rw-rw-r-- M 2032 miller sys 29 May 30 2016 > /n/sources/patch/ramfs-fixes/files > --rw-rw-r-- M 2032 miller sys 272 Nov 6 2016 > /n/sources/patch/wpa-psk/files > --rw-rw-r-- M 2032 fst sys 43 Feb 9 2017 > /n/sources/patch/tcp-halfduplex-close/files > --rw-rw-r-- M 2032 stevesimon sys 44 Feb 21 2017 > /n/sources/patch/sed-unbuffered/files > --rw-rw-r-- M 2032 miller sys 102 Mar 13 2017 > /n/sources/patch/usb-ether-cdc/files > --rw-rw-r-- M 2032 stevesimon sys 38 Mar 14 2017 > /n/sources/patch/httpfile-suicide/files > --rw-rw-rw- M 2032 none sys 41 Jun 29 2017 > /n/sources/patch/ndb-remove-cast/files > --rw-rw-rw- M 2032 none sys 27 Aug 30 2017 > /n/sources/patch/comm-utf-sort/files > --rw-rw-rw- M 2032 none sys 29 Aug 30 2017 > /n/sources/patch/ascii-extra-newline/files > --rw-rw-rw- M 2032 none sys 35 Aug 31 2017 > /n/sources/patch/gmtime-tzoff-unset/files > --rw-rw-r-- M 2032 miller sys 297 Apr 5 2018 > /n/sources/patch/usb-ether-lan78xx/files > --rw-rw-r-- M 2032 miller sys 36 Apr 5 2018 > /n/sources/patch/exec-postnote-race/files > --rw-rw-r-- M 2032 miller sys 30 Apr 5 2018 > /n/sources/patch/exit-wrong-parent/files > --rw-rw-r-- M 2032 miller sys 28 Apr 9 2018 > /n/sources/patch/ssh2-dh-group14/files > --rw-rw-r-- M 2032 miller sys 33 Apr 9 2018 > /n/sources/patch/aes-ctr/files > --rw-rw-r-- M 2032 miller sys 114 Apr 9 2018 > /n/sources/patch/ssh2-aes-ctr/files > cpu% > > Not a huge amount of churn there, but still a "sign of activity". > >> I've been around for a while and I >> would have trouble finding the bits needed for a day-to-day usable >> system outside of the 9front world. > > "Usable" is a function of who's doing the using. I use the Labs version > every day and it does what I need. If another version suits somebody else, > that's great. > > > ------------------------------------------ > 9fans: 9fans > Permalink: > https://9fans.topicbox.com/groups/9fans/Tf27e6479d8812712-M052a3e3f58db7d6a230a0a5a > Delivery options: https://9fans.topicbox.com/groups/9fans/subscription >