From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 27352 invoked from network); 18 Aug 2021 07:19:20 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 18 Aug 2021 07:19:20 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id A0AE8390E0 for ; Wed, 18 Aug 2021 03:19:19 -0400 (EDT) (envelope-from bounce.mMf3f14e2f3b04e34487a920b3.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 9E6353239BEA; Wed, 18 Aug 2021 03:19:19 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=j8VqLQAi header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-pl1-f170.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type:content-transfer-encoding :list-help:list-id:list-post:list-subscribe:reply-to :list-unsubscribe; s=sysmsg-1; t=1629271159; bh=ADQ3l47K6suwjl9M rBPE8d3yVgWFrtP9YWXcgIWj4Lw=; b=o8HnOeapIHRXPUWTxFus+/EgXmKCPDEn I38K0GG2tI73cbxvFQSVr6U3WKA6pqffnWBjYjH+V0+BLFoI60I0ei4uZ4exhUTY 8Ffwd8TQJ9SJ9cWDrsjCDewhxzeq9jkITAuyR2XSSPqcNVm1Rgww7ZdbgcFJib/2 dDBKGp3m9Qk= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1629271159; b=trx7mjRbXDnGRCjhwYfxlMc30u6EvKDkMfun5UrcFgclHQlcW2 vKV7fIOaz9vdhU9H9rER6/2xKEBf/idBoB7gnoEILyGWLdqWE+VppRxhqSzUZCco DG/eHpGdY/eZG9fbWy1pBs2Jd+Y0xa8AQtRtfO0cOF2jdF81qdxv+DI5E= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=j8VqLQAi header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-pl1-f170.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=j8VqLQAi header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.214.170 (mail-pl1-f170.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-pl1-f170.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=meMF0JQH; x-me-sender=none; x-ptr=pass smtp.helo=mail-pl1-f170.google.com policy.ptr=mail-pl1-f170.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:in-reply-to:references:from:date:message-id:subject :to:content-type:content-transfer-encoding:list-help:list-id :list-post:list-subscribe:reply-to:list-unsubscribe; s=dkim-1; bh=ADQ3l47K6suwjl9MrBPE8d3yVgWFrtP9YWXcgIWj4Lw=; b=GDBVTr2ollMv imNiwyG1hYXj+VJMSOehbWpO3WTjkG1R3BsNE09J8SaB5k0FfJxFjxxlfAHylx79 NvwSoeFeaUgJO/GYArJ6qEa1s9WESBn1O6RI0eco2gtuzW2icnI+PaMaB7EiS9yO jwVtFvgGFlQxjljMeRyp/EBY0U4XRF8= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 01CCF32397F8 for <9fans@9fans.net>; Wed, 18 Aug 2021 03:19:10 -0400 (EDT) (envelope-from 23hiro@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 955EBB505E2; Wed, 18 Aug 2021 03:19:09 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1629271149; b=rQk4yo1fsiWk2MoGDQP53pQy/Njj+viKd0eYslceJj/ds9FvJz GvAOC+W3NjN1XyRqwITOwE9r8tNjDQd+XiNr53/6GhdeiS/WRluWjNB3+PiH4qbx LZFJPhLdvkynQDk9u/J5alVqFkJtXQfqjcMwBlKfn/mWJDB0fHWOePkqZ6TtOEKI jN5yYkCZDl5SBTiYZwhdt4T2fM0YpksF+LBblcs0kPEMR9iPazD7/rIYJgSySz6C jpzb2LPv3pA9uhiSj2oVxTJ/5CSSrLWrfq5TUUfhLxxUDtGYIhIQYMwFmgneM0Ab +5lxA52hjp78c097F32F7zJIsDd/lJuB9oqg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type:content-transfer-encoding; s=arcseal; t=1629271149; bh=kmGifH+Yq0+N9IWmpNlO5690s6lER0MJe+I WpcPvDds=; b=GJB7dbDlmTVfQZFYT1jOc8kHKb2njQwbVCn1GwcNjxVs0SxaGa9 4w8n0gCpCZj3wxNZRo7uEO5+lsa4/3pkIHTwmXsRaOJerypqHW9U/YxQp1Xmp5MH jTJ2Q0SMbXx4xfRwfuTygdfml2xlOjrHPCaxsZ19j7vWTu3vMORBxSKIt+Vib14f wZSxjWaqP9PgZ6WNKzFClrN9RETPhVHD02VhY9jESmDgOo+h/cSPx9+PwfIzpMKb kS8I8NZwUVwprko1V+2HHFVzMHci7mpEtHdGA6UMmwdrNlercinX6RNtdms1S7MO VclLTCtMdaWwPqCBglNplHxEViZj5F/yzRg== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=j8VqLQAi header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.214.170 (mail-pl1-f170.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-pl1-f170.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=meMF0JQH; x-me-sender=none; x-ptr=pass smtp.helo=mail-pl1-f170.google.com policy.ptr=mail-pl1-f170.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvtddrleeggdejheculddtuddrgeduhedrtddtmd cutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghn shhusghstghrihgsvgdpuffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtne cunecujfgurhepjghfhfffkffuvfgtgfesthhqredttddtjeenucfhrhhomhephhhirhho uceovdefhhhirhhosehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeetuedvfe dvvdfhkeeukeffgfffffehudeuhfeigfetudeigeehueehleelueekfeenucffohhmrghi nhepthhophhitggsohigrdgtohhmnecukfhppedvtdelrdekhedrvddugedrudejtdenuc evlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddu gedrudejtddphhgvlhhopehmrghilhdqphhluddqfhdujedtrdhgohhoghhlvgdrtghomh dpmhgrihhlfhhrohhmpeeovdefhhhirhhosehgmhgrihhlrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use '23hiro@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="23hiro@gmail.com"; helo=mail-pl1-f170.google.com; client-ip=209.85.214.170 Received: from mail-pl1-f170.google.com (mail-pl1-f170.google.com [209.85.214.170]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 18 Aug 2021 03:19:09 -0400 (EDT) (envelope-from 23hiro@gmail.com) Received: by mail-pl1-f170.google.com with SMTP id e15so1221297plh.8 for <9fans@9fans.net>; Wed, 18 Aug 2021 00:19:09 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:in-reply-to:references:from:date :message-id:subject:to:content-transfer-encoding; bh=kmGifH+Yq0+N9IWmpNlO5690s6lER0MJe+IWpcPvDds=; b=meMF0JQHIOLM99Wr+F7dmlMj+Ri9fCgjQX/Wxql0OKENoedhSNxuS8FZx9kw4xLkxY 1QMo3n7xWyzwEEnCDEIUVHG7qUAlfg8WCXGQbMvhPSC9QZ+N3GRqEM0zIuZk+N+lJWlL llDWgKEM4d00thdNLEhUHZlsiDajJjCPazuRYAJjPjDTOdAKJdWJJHw8cykcChfmKRYy bcumZAr036Zkv3oBMpR7AkELVzILgTTyFySoC0x0ubLFAPZ/fNbDvukDxCWwGfinvbjZ 1x3ffD28VQl8doeoHCdmrts9oSIHW8ZKoum0VWMDD87fl/9YGR7w4WiP8veuwxs1a6ik 7+4g== X-Gm-Message-State: AOAM533gJle6I5ne+GmocaZAv3RycgJ+9QngwZsZ9wqViCS/+Lm+uSXV r8hFwfx5TxAgHkNrZRRFf62zyGKjP3R4fGrdTlsxScKr X-Google-Smtp-Source: ABdhPJyZM9eA5KSiF/Q1LduxYerUFq7cecag7asgPBsU4USrqvtEmxIksyK6CqUcZkBj6fPlyenMErC5qAX3vzmLEVs= X-Received: by 2002:a17:90a:c481:: with SMTP id j1mr3208530pjt.164.1629271148325; Wed, 18 Aug 2021 00:19:08 -0700 (PDT) MIME-Version: 1.0 Received: by 2002:a05:6a20:3210:b029:36:6c8c:f6d1 with HTTP; Wed, 18 Aug 2021 00:19:07 -0700 (PDT) In-Reply-To: References: From: hiro <23hiro@gmail.com> Date: Wed, 18 Aug 2021 09:19:07 +0200 Message-ID: Subject: Re: [9fans] Software philosophy To: 9fans <9fans@9fans.net> Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 9759488a-fff4-11eb-b0e8-ea4cd8f28913 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UOWVmNjQzMGYzMDI1ZTczMS1NZjNmMTRlMmYzYjA0ZTM0NDg3YTky?= =?UTF-8?B?MGIzPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:Mf3f14e2f3b04e34487a920b3:1:LZwrkbtZIepuIV51PNL-DpjwotsWCbjLKbou1Y7c5UQ is that my cue, are you calling in my services?! On 8/18/21, Skip Tavakkolian wrote: > I changed the Subject line to better reflect the discussion. Please do go > on. > > On Tue, Aug 17, 2021 at 8:57 PM Lucio De Re wrote: >> >> On 8/17/21, Keith Gibbs wrote: >> > One Plan Nine? >> > >> > Sure, we have the historical version of the Bell Labs/Lucient codebase, >> > preserved as 9legacy, but yeah we have one currently developed branch >> > of >> > Plan 9 called 9front. Are you proposing that to be called =E2=80=9CPla= n 9 from >> > Bell >> > Labs 5th edition=E2=80=9D? >> > >> I bet you think I don't; you wouldn't ask, otherwise. >> >> > To be serious though, when has monolithic code bases ever benefited >> > things >> > in an Open Source community? >> >> You bought the "exceptionalism" Kool-Aid, lock, stock and barrel, >> haven't you? It's a question of size: a small code base should remain >> small, then it is not weaponisable or monetisable. So we raise the bar >> higher and higher and shake off whatever can't stick hard enough. A >> human natural instinct (more!, gimme more! features! bugs! anything so >> I can have bigger, faster!) bent to the interest of elites (here in >> Africa we know it as the Big Man Syndrome). >> >> > I mean the only reason would be to control who >> > can/cannot make decisions on what goes in the stone soup. >> Do you have incontrovertible evidence? In my caffeine-deprived state, >> I feel you're just following the sheep gospel, no offence intended. In >> my opinion, the trap is always there, ready to be deployed. And the >> masses are always ready to fall into it. Occasionally a Christ figure >> comes along to warn us, but only the elite can understand the message >> and of course they then distort it in the direction that suits them >> best. And the masses are none the wiser, not this time, not the next >> time, not any other time, because the elite can be swapped out >> entirely and the new elite becomes them, ad nauseam. >> >> > There are multiple >> > BSDs. There are multiple Linuxes. Using 9legacy as more than historical >> > baseline means that we will be stuck with decisions put in place 20-30 >> > years >> > ago rather than iterating and moving things forward. The purpose of P9F >> > is >> > to =E2=80=9Cpromote and support=E2=80=9D not to regulate. >> > >> Sure, and an infinite variety of vehicles with wheels at the four >> corners and seats that just occupy space and consume carbon-based >> fuels. Even EVs where each wheel could be both motor and power >> generator have retained that ridiculous formula. But they look >> different (sort of, there's greater difference in time than there in >> style). Oh, let's not ignore that autos also sit idle (my estimate) >> 95% of their life: is that what they are designed for? And the AI in >> my phone, is that also sitting idle? I had a couple of instances >> recently where in the middle of the night my password locked Samsung >> J5 decided to continue reading me the SF short story collection I >> turned off before going to sleep. >> >> But Android is Open Source, isn't it? I can look under the bonned, can't >> I? >> >> Well, the P9F is what it is. It will also become what it is naturally >> attracted to unless some boundaries - Trump's fence? - are put in >> place. >> >> > I would love to imagine a time when we have a resurgence of multiple >> > Plan >> > 9s. I would love to see Akaros and 9atom have a shot in the arm >> > [although >> > much of what the latter had seems to be swallowed up by 9front and >> > 9legacy >> > and the project dead]. I would love to see NIX get a little more >> > traction, >> > as it seems it is just a standalone experiment [albeit a cool one in >> > terms >> > of goals]. I think it would be really healthy for Jeanne and Harvey to >> > be >> > more closer to =E2=80=9Cfamily=E2=80=9D in the community rather than t= hird cousins. Once >> > we >> > have a plurality of opinions, of perspectives, of visions, then we can >> > better broker standards and overall trajectories. >> > >> I'm going to leave this here, with a comment to the effect that I >> totally disagree with the sentiments. There is room, need is not a >> strong enough word for what I'm thinking, for creativity, but software >> is not a primordial soup out of which complex organisms will rise to >> take over the Universe and consume it out of existence, its and >> theirs. >> >> More likely, we'll teach - by example, not intentionally, no - our AI >> products to weaponise the tools we are no longer sufficiently >> naturally intelligent to understand and control (tell me there's a >> difference) and turn us into slaves because, like the human elite, >> they will measure their worth in what they can accumulate (human >> slaves sounds like a neat currency to me, I could use some, it's >> worked in all of human history - ask Epstein), just like their >> creators did. >> >> Nothing to do with Plan 9, of course, because it really is just a drop >> of accidental sanity in an ocean of greed and competition. But, to >> complete the imagery, I'd rather be plankton in a drop of Plan 9 than >> a shark in the Linux Ocean. And I am, to the extent that I support and >> most of all appreciate what makes my ecosystem continue to tick. >> Including any contributions by like-minded or antagonistically natured >> geniuses. >> >> Lucio. >> >> PS: I have a lot of time to think and unfortunately not the means to >> study beyond a rather narrow subject matter. So my opinions are much >> more the result of introspection than of universal knowledge. Take it >> for what it is. >> >> PPS: There is always an elite, its job is to defeat by all means >> available a middle class whose "elite nouveau" continually attempts to >> replace it, by any means available to it. Everything revolves around >> who owns the masses. That's Western Civilisation in a nutshell. ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T9ef6430f3025e731-Mf3f14= e2f3b04e34487a920b3 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription