From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.7 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,MAILING_LIST_MULTI,RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: from tb-ob1.topicbox.com (tb-ob1.topicbox.com [64.147.108.173]) by inbox.vuxu.org (Postfix) with ESMTP id 4F31E22245 for ; Wed, 8 May 2024 22:10:50 +0200 (CEST) Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 659EA35E0F for ; Wed, 8 May 2024 16:10:50 -0400 (EDT) (envelope-from bounce.mM3916ddcf1a499c8241e8c61e.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 6280318A62D6; Wed, 8 May 2024 16:10:50 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Ofqls1+g header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-pj1-f49.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:content-transfer-encoding :list-help:list-id:list-post:list-subscribe:reply-to :list-unsubscribe; s=sysmsg-1; t=1715199050; bh=ZDABlRhapUXg0ef8 UyNMMBI+bYFGQihbreSpI4yM0KE=; b=osJvNl5eVOAqZ/ioQgusAo0MxZZyr/ZS uTGKxAOt1l0oG+PoRSgrNxsEIgupo5wpg176+dJr9fcDGU4t+ERn8ikEWasgIPHv tg5pZw3p2YF9giqbQrjMmA/cN1Us9JbIfcqpPRLX1bkaa+7gTJuYJ7i2Tue5QDnq xzl265oilK4= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1715199050; b=koVxDuRtKPxZ/tvkcguUZ79ApvJ+xyPOaT3gSYCNC5Fkrg481A tGoEOO2rSPDJ5Rcr/lO4ZiHS93cs7OJtZm1H9N8b0p3NoDIxevBx5KzPFC06Aqfx OiYCtGMJJaDCqXA9N+41JAoQJ+sb1NO0XblM5wAu/rB3F3lXJvSbPGwzU= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Ofqls1+g header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-pj1-f49.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Ofqls1+g header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.216.49 (mail-pj1-f49.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-pj1-f49.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=oZRKTfaD; x-me-sender=none; x-ptr=pass smtp.helo=mail-pj1-f49.google.com policy.ptr=mail-pj1-f49.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:content-transfer-encoding:list-help:list-id :list-post:list-subscribe:reply-to:list-unsubscribe; s=dkim-1; t=1715199050; x=1715285450; bh=cG8oqxlV/mpSmMTlE3S6vyzVdUdXt0sl lDFBQw/B8DM=; b=GfZ2/7tNYq2BNWa/rV6QdS3juVj+8wQjpGnvLRki8YRjgQ8O XEm7LTyJkunRhJ0wBKXSSq2WBMyt5SyOAuhfNYK0QomtBj6SUj77a8e81ytrJYyC BON0i8mzPgD7s6brdZJTL3QaGFYOmD/HCxZIge2YmsxrzEti52fPAzAX/dQ= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id DBAF718A5EA5 for <9fans@9fans.net>; Wed, 8 May 2024 16:10:38 -0400 (EDT) (envelope-from 23hiro@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 279B2A775E2; Wed, 8 May 2024 16:10:38 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1715199038; b=J3yyyQ6goV43YZNXTW1JJuk5amFGBXKDd0uTtghRRoQm5ntdO/ EiHsRdlURWXv5PbF9AYSl/go1bdh2/ayVjcC57303hMQp+m8qOJgOAwiMQDJtWhy MbSCu/uqCzALoNIZhxcgh5ODjH7tNSAQZMRhUYBolstXcP6XtgeKOL3hIsFvz9tC QTUFbMwMmJawr0F2e90AF82ly8yy3sq5w0zRowxGmNy0dKzyyJJMmPxMXIdEEXsP 5wW1ooqpNPgGVoDAbcMpXSNlu+xU+bpzt20twS9/DyB+Y8ShAlLk3v+G5MMdExGl aeo36Q7VQ0hWAyTFVVsmD4ijDbfoKbmVvSUg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:content-transfer-encoding; s=arcseal; t=1715199038; bh=w9h4TOUkNBZ0daFf7Q9evyDyprlPM/B/eza WmLiRFFA=; b=kHrJcHeRcBAEe7Lg7hb/90bpjOWHlV3X++fmSOxWS9Qk+5aV4go jlUnZkJWL3rqYue5Yv2vs9uRRwi5xNxgSb+t+UdoV6p/+uMUcJPSwK5ZRugMLZS4 RhkcYo+v6UTeWAytwRliuMyglPze2sJNeCWI9AtP3hwf40T5wA6r1PHdO+bIguu9 0ADzLefwf2gaGqlyv8bSFV8lnvAKkWcsefhfK/2uPBHuUdvyI4EC1j1+B9uPVXsS m76B5Whte9PY8YmWkqkpYsmFvtd375jrSPaXxhxMmSKTpcQZPd0pEz1BMNysVmao GxEN7gS9dErLPksml2pEEgBEhvK527qZC/A== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Ofqls1+g header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.216.49 (mail-pj1-f49.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-pj1-f49.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=oZRKTfaD; x-me-sender=none; x-ptr=pass smtp.helo=mail-pj1-f49.google.com policy.ptr=mail-pj1-f49.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvledrvdeftddgudeggecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhepgghfjg fhfffkuffvtgfgsehtqhertddttdejnecuhfhrohhmpehhihhrohcuoedvfehhihhrohes ghhmrghilhdrtghomheqnecuggftrfgrthhtvghrnheptdekgfeuheevkedtgeekveekhf ffffegheeggeettdetleehveeuhfevgedugedunecuffhomhgrihhnpehtohhpihgtsgho gidrtghomhenucfkphepvddtledrkeehrddvudeirdegleenucevlhhushhtvghrufhiii gvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvdduiedrgeelpdhhvghlohep mhgrihhlqdhpjhduqdhfgeelrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpeeovd efhhhirhhosehgmhgrihhlrdgtohhmqedpnhgspghrtghpthhtohepuddprhgtphhtthho peeolehfrghnsheslehfrghnshdrnhgvtheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use '23hiro@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="23hiro@gmail.com"; helo=mail-pj1-f49.google.com; client-ip=209.85.216.49 Received: from mail-pj1-f49.google.com (mail-pj1-f49.google.com [209.85.216.49]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 8 May 2024 16:10:38 -0400 (EDT) (envelope-from 23hiro@gmail.com) Received: by mail-pj1-f49.google.com with SMTP id 98e67ed59e1d1-2b432ae7dabso43352a91.0 for <9fans@9fans.net>; Wed, 08 May 2024 13:10:38 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1715199037; x=1715803837; h=content-transfer-encoding:to:subject:message-id:date:from :in-reply-to:references:mime-version:x-gm-message-state:from:to:cc :subject:date:message-id:reply-to; bh=w9h4TOUkNBZ0daFf7Q9evyDyprlPM/B/ezaWmLiRFFA=; b=oZRKTfaDy4ZQh2zd62AoHFtj+RHIYD41s+mkKJL9ElPxjVbpejcbZTNNtTm7A6OQFW FK8YL0/vmthZdDNDcl2g2pGOGURX/DM6FH6V1OsjR8PrBnSarLCGif0vWB/a3Xxzl6Su W347qisAn0NB8u4Z2qJU6WH+2ZtndqJRTFPF5jvViOS1IonkNKNWtgGBiNhF9ESkbt8T 0j9+pn08TfjiOcDs+9LFTkAsHwZkNnDKVD1Lb91lPmX7rxu3EGORHXUKgznctRgpPnVo 03vFYnmQ/O0Y6y8u6CIKzvz7Jt9zTLbYMBcDSoOcouJ1HLy5AZOChxa914w4W503Ihf3 owpg== X-Gm-Message-State: AOJu0YwWHeYwf+Sh4zeUHVxn1WSy2LxK6udVaWSSMTnT3+rIoVVJOEmC wbSDLUNFzwEzCI7BDIkRv0cUD0Nc8voYkTCVJj+jR4qeZb30/34x1z3FC+Uyc+PzPyqMXqBq2yF jQh9mILU8Qmmw/UkdZnPZREJLQOL+mk4a X-Google-Smtp-Source: AGHT+IHqhfAYqBOejE13hA8LX7vjR7F15lqmHbEGOw2fC6OKwURcR1kDQAnoe3u1Lew2x8i7qF1Ej9/ZHETxXHcB6zU= X-Received: by 2002:a17:90b:3002:b0:2b2:b080:dd35 with SMTP id 98e67ed59e1d1-2b615af6e05mr3538335a91.0.1715199037212; Wed, 08 May 2024 13:10:37 -0700 (PDT) MIME-Version: 1.0 References: <53b297f4-31d4-48fd-86f4-6b5c2393edc0@app.fastmail.com> In-Reply-To: <53b297f4-31d4-48fd-86f4-6b5c2393edc0@app.fastmail.com> From: hiro <23hiro@gmail.com> Date: Wed, 8 May 2024 22:10:25 +0200 Message-ID: Subject: Re: [9fans] Interoperating between 9legacy and 9front To: 9fans <9fans@9fans.net> Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 0c7a7e08-0d77-11ef-a6fe-b84b8d4a3954 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UZGUyY2EyYWRkYTM4M2EzYS1NMzkxNmRkY2YxYTQ5OWM4MjQxZThj?= =?UTF-8?B?NjFlPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M3916ddcf1a499c8241e8c61e:1:h6I2ySfYwNhHVu-ftYuHh-wAEMf9QpqnPEAfzDFxVIE vester, why do you recommend all these things so overly methodologically that are all already a reality in the 9front community? are you a bot? On Wed, May 8, 2024 at 9:18=E2=80=AFPM wrote: > > Dear Members of the 9legacy and 9front Communities, > > This message is intended to share thoughts on potential improvements to c= ollaborative processes between systems. The aim is to foster an environment= that encourages ongoing enhancement and mutual support. > > Community Efforts > Appreciation is extended to all community members for their dedication in= updating and maintaining these systems. Their efforts are vital to collect= ive progress. > > Community Dialogue > An open forum for all members to share insights, discuss challenges, and = propose solutions related to system updates and integration efforts could p= rove beneficial. Such dialogue can help better understand different perspec= tives and formulate effective strategies collaboratively. > > Collaborative Working Group > The creation of a working group to address specific technical challenges,= such as integrating the dp9ik security protocol, could facilitate smoother= and more efficient integration. Interested members might consider particip= ating in such a group. > > Transparency in Decision-Making > Improving the transparency of decision-making processes is a goal. Sharin= g regular informational updates could keep everyone informed about the prog= ress and decisions that affect both communities. > > Inclusive Decision-Making Processes > Exploring ways to ensure that decision-making processes reflect the commu= nity's needs and inputs is under consideration. Contributions on how to ach= ieve this are highly valued. > > Recognition Program > Recognizing the hard work and achievements of community members is import= ant. Plans to introduce a recognition program that highlights significant c= ontributions and successes are being explored. > > Addressing Historical Concerns > Dedicating time to openly discuss historical concerns is crucial for movi= ng forward. This could help reconcile and strengthen community ties. > > Feedback on these suggestions and potential interest in participating in = these initiatives is invited. Contributions from community members are inva= luable and will help shape the direction of collaborative efforts. > > Thank you for your engagement and commitment to the community. > > Best regards, > Vester > > > On Thu, May 9, 2024, at 01:29, Jacob Moody wrote: > > On 5/8/24 11:06, Lucio De Re wrote: > >> There is much I would like to explain, but the problem I am attempting= to solve ought to have an obvious answer that I am clearly missing. > >> > >> I can't seem to get a 9front workstation to mount a networked 9legacy = fossil service. The FS is a fairly pristine 9legacy installation, on a some= what old 386 platform. I did need to tweak various parameters on both side,= but eventually I got to the point where both hosts declare that the connec= tion has been established; now on the 9front workstation I get the message > >> "srv net!192.96.33.148!9fs: mount failed: fossil authCheck: auth p= rotocol not finished" > >> I suspect the culprit is the lack of the newer "dp9ik" security on 9le= gacy, in which case it would be helpful to know how to work around that. > > > > Probably. Why not just temporarily disable auth checks for the fossil > > 9legacy machine? > > Or perhaps just take a disk/mkfs backup and tar that. You really have > > chosen the most painful way of accomplishing this (which you seem to > > acknowledge). > > Or just exportfs the root? There are so many ways of just getting the > > files. > > > >> > >> Why am I mixing my platforms like this? Because the hardware on which = I am attempting to recover a rather large historical file system is split b= etween IDE and SATA and I have no hardware that can handle both disk modes = and I need to move information between the two media types. I am not descri= bing all the dead ends I tried, incidentally, that would take too long and = really expose my limited understanding. > >> > >> It took almost a day to copy the Fossil cache (or lose a lot of the mo= st recent changes) and now I need (or at least want) to update the default = boot ("arenas") Venti configuration on a SATA drive which I can only access= on hardware I can't install 9legacy on. It's complicated and I'm sure ther= e are people here who would not find this so daunting, but that's where I a= m at. To be precise, I need to change the Fossil default configuration (in = the "fossil" cache) so it points to the correct Venti > >> arenas. I'll deal with the analogous Venti situation when I get past t= he total absence of Fossil tools on 9front. > >> > >> I guess I can port fossil/conf to 9front, but I'm not sure I have the = stomach to try that. Maybe now that I have raised the possibility... > > > > It sound like you're trying to make this someone else's problem. > > Being stuck in a hardware pickle when there are ample existing software > > solutions is not > > a good reason to ask someone else to go out of their way to write > > software. > > > > Fossil can be pulled in largely without modifications as I understand i= t, > > I don't run fossil but some people in the 9front community do and it do= es > > not appear to me that they've had issues with continuing to have it work > > (other then fossil bugs itself). > > > >> > >> I managed to share the Fossil cache through a NetBSD server providing = u9fs services, but that host does not have the capacity to store the Venti = arenas, nor can I really justify spending the amount of time it would take = to pass it between the 9legacy and 9front devices via NetBSD, no matter how= I try to arrange that. It does baffle me, though, that a NetBSD intermedia= ry is more competent than the two "native" platforms. > > > > Are you blaming us for moving on from AES 53 bit keys that can be brute > > forced in an afternoon? > > I have tried to open a dialogue for getting dp9ik on 9legacy a couple > > times now, when I had brought it > > up I am told to write the patch. Something about being asked to spend > > the work to write a patch for 9legacy given > > the historical context of why 9front exists does not sit right with me. > > So it wont be me, sorry. > > Sure it sucks that things have drifted, but all our code is there, > > neatly organized out in to commits, if someone > > wants to import our work it is readily available. However something > > tells me most people are just going to use 9front as is. > > > > Good luck, > > moody > > ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/Tde2ca2adda383a3a-M3916d= dcf1a499c8241e8c61e Delivery options: https://9fans.topicbox.com/groups/9fans/subscription