From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 24269 invoked from network); 29 Jan 2022 13:25:04 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 29 Jan 2022 13:25:04 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 8735D2C9B1 for ; Sat, 29 Jan 2022 08:25:03 -0500 (EST) (envelope-from bounce.mMed453f69a198d3406e5213c9.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 80F3D1449C6E; Sat, 29 Jan 2022 08:25:03 -0500 (EST) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=VHpni495 header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-vk1-f182.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1643462703; bh=bE6A6RhKXLi50rVm fNajHKOYXDtaLL4Jtfy0qDf/v8g=; b=TG0BGn7/ScxpMTVSILsLARSr8ni9rKVu Buy+FQplwkESFi/VzIdPtDyEzEOGCP0r4TWjqaAGAPS8metTNMrd0KdcRfZ8Vb4F lJFjRBY7qZ9BEah3up/q+kaB0TwlU0tWtt44BserWJDejJygZrd4n+v/QXbSGLhp MnwgMWc5T+4= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1643462703; b=eKyT8wlNNJ1ygm/0jrGfxyU9+2IGiOYX3k62/RoUbNok34+DHM H6LJ/cBlt9Ty+SEu+pZE/v9XXRpLqtMmrYVI6x3rSY7vciclgH4Go5PfhOVOMN+c uauqNfMcNT+Z6wANQ6N68MHAVGqGAs55NpTd4gERR7ROdBY44hR475iLQ= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=VHpni495 header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-vk1-f182.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=VHpni495 header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.182 (mail-vk1-f182.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-vk1-f182.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=4cRd11vp; x-me-sender=none; x-ptr=pass smtp.helo=mail-vk1-f182.google.com policy.ptr=mail-vk1-f182.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:in-reply-to:references:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; bh=bE6A6RhKXLi50rVmfNajHKOYXDtaLL4Jtfy0qDf/v8g=; b=W6qzxOLH49Dd TEowUJogKkbMClwdemD4rMHUf0zxWdi271qLWLDqEVaJmEPdljL7QxeZz95lXr4t +UKl4LaZMtIWfK5J5m9i0m7iKks6/89mdzCSmfOAuUpXeywthzkIAHbdEka6LV1k R+FyIgTrsds7eXjmlCe2z0E0F99T9y4= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 20AB1FCF36B for <9fans@9fans.net>; Sat, 29 Jan 2022 08:24:51 -0500 (EST) (envelope-from 23hiro@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 30A76CD1812; Sat, 29 Jan 2022 08:24:51 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1643462690; b=PF95rBiBZplDN1WwUVWjCtakr+4xshza1nbYCQwA/hMrly8aac bsvnk0SjDIRHtVFrf6eroTYaaXBHEG9DD03PSyPLcHrfydL6v4bHztOUAj69kihE gARpctJO9XH/fcgtwoqdPHLo4t46ophifQkZOmLicpkOs/QhLsR+rG+5e7XxQyFv GMceTzgwAs/JuZ9SrAdAIFNVehlEtenUPcwmh41EaAGWsBJ7fw+TThyy124AYWti YrhyagyN5mDlNvx4AKLBvMQIy4h8wlqypS2+zDG2XJRNieflpvOwSDCOAO1r2E3V ztIrRRWUpU4Kbd3cLQZJWNptuw8JRpQ1RW1A== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type; s=arcseal; t=1643462690; bh=brp5mHqgIdHW298uUdNNQziVKiTDwNqmpK/f4/myASA=; b=RKKKl4pNuGS2 S1dbXWadyENlUWGTy8z8oCk9lleF9x1OTpqPoKSzOMaV2uoS33GdOxf3PRxlVAxh K/apXVAivnZkgw4r2blo1kiAHr0S3qCNo1jSVAVkYp382yvRdI7jz+iMBtr0rDg7 cyNy3FX4HSmp5hIelAM044p4ksxkLmss1lUrd/GCajRavnrs01ZCjywFk/pwvhT+ up+YF2VEXj6XEV9dkmoqTFXMdPwsB7J4M6a2cZjGfvnZlH7iW1bhGJhUT6aUuIu3 NDx70sBZ9CZm1MKnD3WrN/QFtzR1qAyM+AglZ5+cMXdjauLVx3zkZ07bqEnkF8Y4 cqjwKxHtzw== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=VHpni495 header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.182 (mail-vk1-f182.google.com); spf=pass smtp.mailfrom=23hiro@gmail.com smtp.helo=mail-vk1-f182.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=4cRd11vp; x-me-sender=none; x-ptr=pass smtp.helo=mail-vk1-f182.google.com policy.ptr=mail-vk1-f182.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvvddrfeeigddutdefucdltddurdegudelrddttd dmucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgf nhhsuhgsshgtrhhisggvpdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttd enucenucfjughrpegjfhfhfffkuffvtgesthdtredttddtjeenucfhrhhomhephhhirhho uceovdefhhhirhhosehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpedtveekve ffvdeiieetuedvgffhudekhfeltdevhefgfeekleffheelhedtvdeigfenucffohhmrghi nhepthhophhitggsohigrdgtohhmnecukfhppedvtdelrdekhedrvddvuddrudekvdenuc evlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddv uddrudekvddphhgvlhhopehmrghilhdqvhhkuddqfhdukedvrdhgohhoghhlvgdrtghomh dpmhgrihhlfhhrohhmpeeovdefhhhirhhosehgmhgrihhlrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use '23hiro@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="23hiro@gmail.com"; helo=mail-vk1-f182.google.com; client-ip=209.85.221.182 Received: from mail-vk1-f182.google.com (mail-vk1-f182.google.com [209.85.221.182]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sat, 29 Jan 2022 08:24:50 -0500 (EST) (envelope-from 23hiro@gmail.com) Received: by mail-vk1-f182.google.com with SMTP id 48so5564763vki.0 for <9fans@9fans.net>; Sat, 29 Jan 2022 05:24:50 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:in-reply-to:references:from:date :message-id:subject:to; bh=brp5mHqgIdHW298uUdNNQziVKiTDwNqmpK/f4/myASA=; b=4cRd11vpJn8/i5OMe9FdZjpO3eVpRqcGhkKSaYtcKuxMHOfOWSUwQpm2eWy6/Qe3C8 srgewi05hrF1YuZxPBjbLzShGuJ2GS/7K7i8tZACeclGEENS483EHl91iCuKfsdxxVey AQkJctJjrh6WI/MoRUoDciC/90LpSinZXs8+bBVtfZUafDWxLoVUmHF9Xn19oyPxrUTV tOI3HyMZpWfdiaCPpfiSc1rjQmbdxtMgSIEBYKxUffI/RRHKH3LeQnaFvKP1zSMa/xuh jgp9RV0Nj5DPuWvxfDdSGkWZefrKQ7ONUgspuTTGfOf1qToDk1zLb6NOiu3DJW07DzH+ WGig== X-Gm-Message-State: AOAM531UDiLTBFvEvfRFsDRUJpOD7rAfLZ6PLVMqHyn+D0ZIcEgxGgk+ l3lSnd81MYqdXWzJCe3sNV3jPOgK4Phz1f1NCqlZlff88go= X-Google-Smtp-Source: ABdhPJyya6QKXZZwCCw/+hthtP6tVVH9H957lI8XW/NX+Mewr63GdEABCF4pZAg6eTWG9LAEx18jjLP6HQvBjzlpHN0= X-Received: by 2002:a05:6122:130e:: with SMTP id e14mr4936682vkp.26.1643462689923; Sat, 29 Jan 2022 05:24:49 -0800 (PST) MIME-Version: 1.0 Received: by 2002:a05:612c:4c4:b0:287:6dd5:bed9 with HTTP; Sat, 29 Jan 2022 05:24:49 -0800 (PST) In-Reply-To: <16434613850.BC38c.59069@composer.9fans.topicbox.com> References: <16433324650.ff90B.935638@composer.9fans.topicbox.com> <16433713090.e62E5Cc03.507002@composer.9fans.topicbox.com> <16434613850.BC38c.59069@composer.9fans.topicbox.com> From: hiro <23hiro@gmail.com> Date: Sat, 29 Jan 2022 14:24:49 +0100 Message-ID: Subject: Re: [9fans] licence question To: 9fans <9fans@9fans.net> Content-Type: text/plain; charset=UTF-8 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: d9077688-8106-11ec-827a-bf24a2f66b3e Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UM2UwN2JmZGYyNjNhODNjOC1NZWQ0NTNmNjlhMTk4ZDM0MDZlNTIx?= =?UTF-8?B?M2M5Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: quoted-printable List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:Med453f69a198d3406e5213c9:1:vfWUqvkDPz6Jn-7hioCiLB1B7DwldJnIP6mm_fTyzFw i never cared about the gpl license. it didn't improve anything as it's less permissive than we had before. i still see a risk when math&electrical engineers will be barred access to the sourcecode. maybe they would find a beautiful solution by changing a few lines of code, allowing you to improve your (one-man-project ?) system. generally i think if all users can change the code and recompile everything, this makes it infinitely more maintainable. one of the best things about plan9 is that all source and binaries are all part of the distribution and installation, and easily re-(cross-)compilable by anybody. i don't buy the argument that source code would be too big. for just one subject in school i had to download many gigabytes of quartus, over a decade ago. our source is nowhere near that big. On 1/29/22, ibrahim via 9fans <9fans@9fans.net> wrote: > On Friday, 28 January 2022, at 10:59 PM, hiro wrote: >> why should it be closed source? > you're gonna seriously put the effort to remove all the traces of source > files? >=20 > This kiosk app is meant for students in math, electrotechnics, mechanics = ... > its a closed area network where only registered students can connect. This > plattform is only meant for exchange of data and informations. The app is > distributed as an iso to be run from bare hardware or qemu (virtual box). > The current version is running based on FreeBSD and has a size caused by = X11 > necessity and accompanying programs of 800 MB. I'm trying to reduce the s= ize > and increasing the performance by using plan9. My plattform generates form > many simulation tasks, symbolic calculations, plotting, ... intermediate C > code and translates this to programs which are called as child processes = and > generate their output for rendering. LLVM is needed two times in the Free= BSD > installation once for X11 and once as a system compiler. By using plan9 I > can reduce the size of this kiosk application to estimated 300 MB. I gave > plan9 a try a few years ago and was fascinated but the licence wasn't > attractive at that time. But now it's ideal for such tasks. >=20 > Some sources are part of this installment inside a loop file those are > provided internally with a ramfs so in time compilation gets possible. The > moment I include GPL licensed code into this ramfs this would infect my o= wn > licence. My plattform is BSD 2 claused the students can distribute it fre= ely > but the mechanics for connecting to the closed area network are hidden. T= he > MIT licence, zlib, Ogg Vorbis license are compatible with BSD 2 license a= nd > require proper acknowlegdement but GPL can't be used in such a manner. >=20 > Plan9 with its new license is optimal for such applications. I think that > plan9 would have been more wide spread if this new license would have been > applied from the beginning. And I believe that the reason why NetBSD, > OpenBSD, FreeBSD are not as wide spread as Linux was the lack of a compil= er > suite conforming to the BSD license. Some time ago the BSD project asked = for > a license change for plan9 to integrate the C compiler which didn't happen > at that time. But I'm sure that in the near future their will be some BSD > forks which will take more ideas and tools from Plan9 (especially the > compiler suite). Plan9 has more advantages besides those - nearly direct > access to the hardware and a simplified way to enhancements due to its > namespaces and 9fs. >=20 > I'm using BSD systems since 1991 and I think its important to follow a > strict licensing scheme otherwise many years later as it happened in NetB= SD, > FreeBSD and OpenBSD you start to search for alternative implementations > cause at some point your code is not accompanied by incompatible licensed > code but is depending on those so it is infected. If you decide to > distribute a system with a non infecting open source license than its > important to do this in a consistent form. The more time passes the more = you > depend on parts and the less gets the chance to exchange those parts. >=20 > I am consequently avoiding infecting licenses in my projects and my > distributions for decades now and those parts of plan9 (9front) which are > not conforming are not a big deal to throw away. diff, patch are available > in conforming licensed versions. I prefer ogg vorbis to mp3 due to its > patent problems in the past. There are dozens of truetype fonts with bett= er > quality and distributable. The only problematic part not only to plan9 but > also all BSD systems is ghostscript but I have an existing translater from > postscript to svg and a closed source svg library for rendering for other > projects where I would perhaps need page and the dependency to ghostscrip= t. > No need for lzip and xen ... >=20 > The reason why this reply was this long is simple : >=20 > My experience from the past and my involvements in BSD projects tought me > that many open source projects try to take large steps in short time and > most often they borrow code or libraries from projects not conforming with > their chosen license. Legal questions are taken very lightly for a few ye= ars > but than at some point in time those legal questions surface. The reason = why > linux took over was this simple - BSD 4.3 lost its compilers. >=20 > There are people (I am one of them) who also have to write commercial > projects for a living. I'm developing embedded software for electronic > circuits and plan9 is now a real alternative for me cause of its new > license. I can decide for each project if I want to make it open source or > not. And by consequently avoiding infecting licenses I can use the same c= ode > base for open source as well as closed source projects. >=20 > Why do you think p9f asked for a relicensing of plan9 while it was already > gpl licensed a few years ago ? Both are redistributable but the MIT versi= on > is also usable for closed source commercial projects while the GPL version > is not. Does this matter ? Yes of course it matters for people or compani= es. > Its sometimes amusing to see developers taking legal issues lightly. >=20 > I'm not an advocate but be assured : The moment you distribute lets say a > set top box based on plan9 using legacy9 or 9front and you don't delete > those mentioned parts from your distribution you can't make it closed > source. If your set top box plays mp3 or opens a pdf ps file by using > ghostscript and this is a significant part of the functionality you have > created a derived work based on or depending on GPL'ed code. To solve this > problem you would have to seperate those parts from your hardware and make > it downloadable to keep it closed source. But this wouldn't be a real > solution because page depends on the existence of ghostscript to display = pdf > and ps files so you have a 1:1 dependency. FSF perhaps won't take this > seriously. Aladdin will because they offer a commercial license alternati= ve. > And your concurrents will also look closely to make your product open > sourced. This is not fiction this is reality happening hundreds of times = per > year. ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T3e07bfdf263a83c8-Med453= f69a198d3406e5213c9 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription