From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 9535A1E8B6F0 for <9fans@9fans.net>; Fri, 27 Mar 2020 08:25:48 -0400 (EDT) (envelope-from ole.hjalmar.kristensen@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id F12192F70AE; Fri, 27 Mar 2020 08:25:48 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1585311948; b=HhNH+bywBmXfJUgR9cUZT5cw3N2JOv83d/LVwrWo16W3McWbzu 4P3/v8XVdte1nCf+UWcI1j50qZpOlUl4lrv8Upsu4pL43zyGdCvklSi/8UQ8sH2q KkL3ZU0oKMVqzzC0we9xcBe0LqvMox9y9Tt/liDAY0H9GJ3mNkQZUZeXCdd/PwXo GZ/yYymI2zTS0c5Lsj3XvMBhD0CCRDhd2XlJkjIXadG59GCZ5hORV8AEcpPufd6h XwNWfJjd9dpaeox8QZaUWG4TfsPtMZBBJ/cfTDkAbuyPD9S92hJQyuF2borvlsv2 GKi/fhuvZLgzj3lbaqgHWs3pQSKZlVuV9d1g== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1585311948; bh=F2GBPSrWLndDILM7/KILN2qaEW4NLxfNKMkaRM7MGKI=; b=f8aKg5rc9oeJ /YMa0xwsTbIVT1Jj0+iC4+XrpNeSbmCUVgRdg9b69KjZYTBSN0CACoGrWdXhiC41 /GcO9CSQ/1XgXyBZ+iYPSHnfzTTxwB/8+h5XAunAUd2kVn9HAAyJyfJBQSJgVzkz +4Mg2Vv9JssNE3ovfZI7lFdZ9ofOzSOTAwsE2/xm+OZGZiDd1CaGDQnySMWmYT/A MziOIYtyLk0JSyNO62MA0rmDtvdHhMwhl+mA4Utce4zCjkNSOlhyoKZpHcdUPV1M /PCMv/jewhctBvUrI1/saIzo/mqbvB0SFMCUKLcPXi0HWp46W3TyEdpK4wA5TM2b FWwRg28wgw== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=BvmKwOFs header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.208.180 (mail-lj1-f180.google.com); spf=pass smtp.mailfrom=ole.hjalmar.kristensen@gmail.com smtp.helo=mail-lj1-f180.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=d5PvbKoJ; x-ptr=pass smtp.helo=mail-lj1-f180.google.com policy.ptr=mail-lj1-f180.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=BvmKwOFs header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.208.180 (mail-lj1-f180.google.com); spf=pass smtp.mailfrom=ole.hjalmar.kristensen@gmail.com smtp.helo=mail-lj1-f180.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=d5PvbKoJ; x-ptr=pass smtp.helo=mail-lj1-f180.google.com policy.ptr=mail-lj1-f180.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedugedrudehledgfeekucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf ffkffuvfgtsegrtderredttdejnecuhfhrohhmpefqlhgvqdfjjhgrlhhmrghrucfmrhhi shhtvghnshgvnhcuoeholhgvrdhhjhgrlhhmrghrrdhkrhhishhtvghnshgvnhesghhmrg hilhdrtghomheqnecuffhomhgrihhnpehgihhthhhusgdrtghomhdpthhophhitggsohig rdgtohhmnecukfhppedvtdelrdekhedrvddtkedrudektdenucevlhhushhtvghrufhiii gvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddtkedrudektddphhgvlhho pehmrghilhdqlhhjuddqfhdukedtrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpe eoohhlvgdrhhhjrghlmhgrrhdrkhhrihhsthgvnhhsvghnsehgmhgrihhlrdgtohhmqecu uffkkgfgpeekieekge X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'ole.hjalmar.kristensen@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="ole.hjalmar.kristensen@gmail.com"; helo=mail-lj1-f180.google.com; client-ip=209.85.208.180 Received: from mail-lj1-f180.google.com (mail-lj1-f180.google.com [209.85.208.180]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 27 Mar 2020 08:25:48 -0400 (EDT) (envelope-from ole.hjalmar.kristensen@gmail.com) Received: by mail-lj1-f180.google.com with SMTP id t17so9965254ljc.12 for <9fans@9fans.net>; Fri, 27 Mar 2020 05:25:48 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=F2GBPSrWLndDILM7/KILN2qaEW4NLxfNKMkaRM7MGKI=; b=BvmKwOFsCqpM4Hv+0IeBbXuRHFR1N/a04UOnu6wRWln9gyOB6l2sHQmUzguFn4E/VB uUF4w2dIJGZgW3qHxdiBPSwT+VRNkzZ/PHVyPhztC39XhLTUzyXD7Y06+wKw+U0NpmC4 ghErP8yHcmMXemMEUak0noBX+w/+MSm78Jpk6MdiuUN0dyV1OxtAR9u8+VpIZdiwk42c 23tfiBNqw4Hv0iEa4YeL5PwqwGvd5FcznKkeL0QUfED4gzjK1f/xlCl/mZ+qDYQWSD8T Mpj9V+nuebVE+cUhW7JMsIgJdxmcrLD/b2BLDGX8hl3wcTPp1btjN/k+SO0nJ/d4maws H5sA== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=F2GBPSrWLndDILM7/KILN2qaEW4NLxfNKMkaRM7MGKI=; b=d5PvbKoJ/fpG9sfvD0U/jNeD5+HBMVTpROLcJzJpUOiPglSx8oe5xYQlyrLndMYo2J HV2qWg+ytH2DikAsbwCOhSbkRaTU1u8sug5b1V5vMlD9vaiHsNHDI6BnpRPONlbzKuyE BKU2OThr0RfjCJxwJrhoEDh/uoJGoC38wSr3G8O8vTpdpzSxf4L8yTnic0VAIly9qe5R x97qU1nZx8id6Z45OUHeOJNK/rj48/jqPAFvGoR2//IQsEkzjj7x9EohKND4gvADnVHj uYP8vADI5UbS8npp2DV+scaBZvSCJ7cD0GqTUmARb6jXl350vt8xsUDv3T1R+Jwn/6n6 wySA== X-Gm-Message-State: ANhLgQ1IfCezQ9eHAZpUqOL5IPnugOgDtxJzvYCvMbrQLpNnq4DM8i0z 4r9LYoB6rUf3E2O307Crvf9LtZcYQtT9C3zkLUFcBULR X-Google-Smtp-Source: APiQypJNfnqQz06PlRXJSpjRFrPYUDSaZFsSzhFY35t3jBZezYB+buJujR/hKVMV4E1antIiN6gCobNrKvMnJm3ko+E= X-Received: by 2002:a2e:8e2a:: with SMTP id r10mr8169099ljk.276.1585311946467; Fri, 27 Mar 2020 05:25:46 -0700 (PDT) MIME-Version: 1.0 References: <5EC1C11A-69EB-4248-B8F1-D348F70A89CA@9srv.net> In-Reply-To: <5EC1C11A-69EB-4248-B8F1-D348F70A89CA@9srv.net> From: Ole-Hjalmar Kristensen Date: Fri, 27 Mar 2020 13:25:34 +0100 Message-ID: Subject: Re: [9fans] iOS drawterm To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="0000000000006d6c6b05a1d533ed" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 19ac1638-7026-11ea-b2f5-d661dfe427c6 --0000000000006d6c6b05a1d533ed Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I think I agree. Besides, drawterm isn't that bad even over high-latency VPN. I experimented a bit by running drawterm at work against a plan9 server at home, and it was quite usable, and much better than Emacs running over X using the same connection. Of course, Emacs IS notoriously bad at this... On Wed, Mar 25, 2020 at 6:28 PM Anthony Sorace wrote: > VNC is great for what it is, and I certainly wouldn=E2=80=99t object to s= eeing > vncs upgraded, but it is not a replacement for drawterm. It does not expo= se > local devices in a plan 9 friendly way. In addition to just using drawter= m > as a straightforward terminal, an iOS version would be a very good platfo= rm > for playing around with exposing other capabilities that the device has t= o > plan 9. I played around with this a little bit with the original port. VN= C > buys us none of this. > > On Mar 25, 2020, at 04:21, Kim Lassila wrote: > > =EF=BB=BF > > On Mar 25, 2020, at 8:19 AM, Anthony Sorace wrote: > > With iOS getting first-class mouse pointer support, I=E2=80=99m looking a= t the iOS > drawterm port again. Has anyone touched this since the old GSoC project b= it > rotted out? > > > Drawterm is quite slow at reading and writing pixels on the screen. I > learned this when I started recording screen in Plan 9 ( > https://github.com/9d0/screencast). > > Instead of porting drawterm to different platforms I would like to see > vncs improved to support the latest version of the Remote Framebuffer > Protocol (RFC 6143). This would allow a standard VNC client to connect to= a > Plan 9 terminal, support screen resizing, local mouse cursor, and deliver > all key strokes and mouse chords accurately. VNC is optimized to work ove= r > a large variety of different networks including high latency links and it > will therefore offer a better user experience than drawterm, especially > over wireless. > > Kim > > *9fans * / 9fans / see discussions > + participants > + delivery options > Permalink > > --0000000000006d6c6b05a1d533ed Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
I think I agree. Besides, drawterm isn't that bad even= over high-latency VPN. I experimented a bit by running drawterm at work ag= ainst a plan9 server at home, and it was quite usable, and much better than= Emacs running over X using the same connection. Of course, Emacs IS notori= ously bad at this...

On Wed, Mar 25, 2020 at 6:28 PM Anthony Sorace <a@9srv.net> wrote:
VNC = is great for what it is, and I certainly wouldn=E2=80=99t object to seeing = vncs upgraded, but it is not a replacement for drawterm. It does not expose= local devices in a plan 9 friendly way. In addition to just using drawterm= as a straightforward terminal, an iOS version would be a very good platfor= m for playing around with exposing other capabilities that the device has t= o plan 9. I played around with this a little bit with the original port. VN= C buys us none of this.

On Mar 25, 2020, at 04:21, Kim Lassila <kim.lassila@gmail.com> wrote:

=EF=BB=BF

On Mar 25, 2020, at 8:19 AM, Anthony S= orace <a@9srv.net>= ; wrote:

With iOS getting first-class mouse pointer supp= ort, I=E2=80=99m looking at the iOS drawterm port again. Has anyone touched= this since the old GSoC project bit rotted out?

Drawterm is quite slow at reading and writing pixels on th= e screen. I learned this when I started recording screen in Plan 9 (https://github.com= /9d0/screencast).=C2=A0

Instead of porting dra= wterm to different platforms I would like to see vncs improved to support t= he latest version of the Remote Framebuffer Protocol (RFC 6143). This would= allow a standard VNC client to connect to a Plan 9 terminal, support scree= n resizing, local mouse cursor, and deliver all key strokes and mouse chord= s accurately. VNC is optimized to work over a large variety of different ne= tworks including high latency links and it will therefore offer a better us= er experience than drawterm, especially over wireless.=C2=A0

=
Kim

9fans / 9fans / see discu= ssions + participants + delivery options Permalink
--0000000000006d6c6b05a1d533ed--