From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H2 autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 4094 invoked from network); 18 Aug 2021 03:55:55 -0000 Received: from tb-ob0.topicbox.com (64.147.108.117) by inbox.vuxu.org with ESMTPUTF8; 18 Aug 2021 03:55:55 -0000 Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 2E82733875 for ; Tue, 17 Aug 2021 23:55:52 -0400 (EDT) (envelope-from bounce.mM52ee3c3eec22dd0009406d54.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 28B9D32FD0B6; Tue, 17 Aug 2021 23:55:52 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=i+6zNeJH header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f42.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type:content-transfer-encoding :list-help:list-id:list-post:list-subscribe:reply-to :list-unsubscribe; s=sysmsg-1; t=1629258952; bh=7x09L0eKGmh3Ym8T 2IYLmsxUh9PM0bqaacQaQoTrX4c=; b=uM7yKB9/tO3bwDgxbL4zkFAVyGohNnUu 39HK/saQTRyuBGeJn8KQRWekTHpwx/pW8csiQkimI2VrkZq7qqXCTIO6deyzlkUt SjCV1IiXl8C4A7LAAtQo1FzHggwUQU7MjKB+bnL58NEm4ibGxGYCRxKeNYzUxeDE v2hGrBgAHrE= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1629258952; b=f8vfIdjf91JkM5TNKhomdL3cifLfXIIntNVx70ZkeoyuzOwfMS zkQdImk8tv0dE90GYpnQV7BxAnfIwtzjtf9UWdrV83dJ3UlNSdFZbS0X0pMEf2Yp sV83FziHqYWvZ5ICVhvhAcL4yNP9/tFZ4nrvtME0MJhmbZVmCEEGbX3Uk= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=i+6zNeJH header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f42.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=i+6zNeJH header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.42 (mail-lf1-f42.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f42.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=TDCh4x1c; x-me-sender=none; x-ptr=pass smtp.helo=mail-lf1-f42.google.com policy.ptr=mail-lf1-f42.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:in-reply-to:references:from:date:message-id:subject :to:content-type:content-transfer-encoding:list-help:list-id :list-post:list-subscribe:reply-to:list-unsubscribe; s=dkim-1; bh=7x09L0eKGmh3Ym8T2IYLmsxUh9PM0bqaacQaQoTrX4c=; b=AMSb0+EaGblD EmGnMfSSaczvk6c7rxKV1IiVeJ119s0l5QvOH9PV92ngUy5QeFM5+XYCgvY9S5ty AumC+BQiNErHukCs4mjRvM5o//mT536olU106GXaCnmrHHQL+3QFgM45z/Re/Bcb Yz0YbEyy7MRhOqdThvtRYGZCXZqcRE4= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 5E4273235671 for <9fans@9fans.net>; Tue, 17 Aug 2021 23:55:39 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id C95DF3C202C; Tue, 17 Aug 2021 23:55:39 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1629258939; b=fxai/TGqse4lJzvwaoMHjU1a8nmrxJkLVGQSxwrtCRhn1lO4+C acspMmUS6L71VATcCsdR1mWgPaKHOTD32EM4NJs/Lmod1VkHCHUiJ2c8UZgjN5cD kzjwrwFFocmmlHD9fLa9pdsr5DjcUNXi9KLE9dpRbDV1KloEredcNAXU+SlLiZdU OeS8pFAY18kKycqTvqJpkIjSDuTjTj2mG8ixooZxVI0fd/JdH7HffN9ezjzcQjJW usChgRmIT5C6rwPXw5Kvm6bhVTGNAmtWXwBYeEFdvMRt++uX7v3n2M5/5Y8CmGyN mO4krlNmIWHUfkAJuohH3xWr8eJGQTXi/UzA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:content-type:content-transfer-encoding; s=arcseal; t=1629258939; bh=V7lbhrWakFIityO6jOxttKCWxCw2do9bl22 nbKgj0yA=; b=SjKNGr9+p4sfrqPW07JyOt/EAFNr07z7le09QHAXOi3G06LG+1F 5Z7rX0REomAGVUMt50zNeioJ1mhau8EqNOPwnevjueGcDy/JKC76oepDgOVj5tEW FKmRZ8zCLKEmPwpW23Pr9MdRDERMn3HX/6FOCqeNnILT1lRtjs0VqHlt/y3vsUyM q1wiuR5G2otQo4X3vTg1wpAOACK+C3JKQc4DnUbz9lOnwd+mC3uWIH07xDDofeQa QM/I1XgDjnCkWtL4Rcm1rtTYj/TJimjidhyVYV90Gu9FIFlwohNw8D2lM+GuvSq8 RPpCNXf7JoPnBZ5eW0vrhVyJdy7S/84seeQ== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=i+6zNeJH header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.42 (mail-lf1-f42.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f42.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=TDCh4x1c; x-me-sender=none; x-ptr=pass smtp.helo=mail-lf1-f42.google.com policy.ptr=mail-lf1-f42.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvtddrkeelucdltddurdegudelrddttddmucetuf doteggodetrfdotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgs shgtrhhisggvpdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenuc fjughrpegjfhfhfffkuffvtgfgsehtqhertddttdejnecuhfhrohhmpefnuhgtihhoucff vgcutfgvuceolhhutghiohdruggvrhgvsehgmhgrihhlrdgtohhmqeenucggtffrrghtth gvrhhnpeejgfffieetvefhgfefieeitdeujeffueejfffgffeitdekhfelvdelveeuhfev keenucfkphepvddtledrkeehrdduieejrdegvdenucevlhhushhtvghrufhiiigvpedtne curfgrrhgrmhepihhnvghtpedvtdelrdekhedrudeijedrgedvpdhhvghlohepmhgrihhl qdhlfhduqdhfgedvrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpeeolhhutghioh druggvrhgvsehgmhgrihhlrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'lucio.dere@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="lucio.dere@gmail.com"; helo=mail-lf1-f42.google.com; client-ip=209.85.167.42 Received: from mail-lf1-f42.google.com (mail-lf1-f42.google.com [209.85.167.42]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Tue, 17 Aug 2021 23:55:38 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: by mail-lf1-f42.google.com with SMTP id u22so1573318lfq.13 for <9fans@9fans.net>; Tue, 17 Aug 2021 20:55:38 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:in-reply-to:references:from:date :message-id:subject:to:content-transfer-encoding; bh=V7lbhrWakFIityO6jOxttKCWxCw2do9bl22nbKgj0yA=; b=TDCh4x1cuJVQyd40MlKPn2lQInihA5OkEKye+vePxn172xf8Nd709w5kutk3B27C1C O7Ws8cF2IYjTTDn+VSgcNdlyIrOPknnysmesq+f1ymClUEh0n4ql9FAETyU8ZBghi3OQ aXzPKZurOBRqZJFlPs6xbinK+Novx9A8WygyCKWkPQMwvmbPDW3ecCz3BdXLK1pGo0SO cOTOqnAiizxmScfwGoI52yXQKX03eTX+8pI79pq1elRaQHyuagJnEOM6dtg3qXdZ1wrz DlrWe3sSVzyu7AO9QSYMTjCFun9TeV11G/AEB5uFrGtHKR5QxA2yzjbaDrC646Lsnjkw 7g8A== X-Gm-Message-State: AOAM532lTv9dREQaqi6cn9DJkaH5JtZE5XalWmAbyNv2VdEn/6fdTpG1 NiGlAuh5U1qj0qNWCXksM++qyB1EJS21oSDgJNBb1d/kAPE= X-Google-Smtp-Source: ABdhPJxUvtL7vr6FjDr3bO7NbVj+Z9PWun4E5nVacThDhmR2yJIMELk/1EODt3MwfAln0TFUYQS9YJZDGND/8VhbiXg= X-Received: by 2002:a05:6512:3e06:: with SMTP id i6mr4744043lfv.81.1629258936961; Tue, 17 Aug 2021 20:55:36 -0700 (PDT) MIME-Version: 1.0 Received: by 2002:a2e:7606:0:0:0:0:0 with HTTP; Tue, 17 Aug 2021 20:55:36 -0700 (PDT) In-Reply-To: References: From: Lucio De Re Date: Wed, 18 Aug 2021 05:55:36 +0200 Message-ID: Subject: Re: [9fans] OAuth2 in factotum To: 9fans <9fans@9fans.net> Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 2946be02-ffd8-11eb-88b4-868a1883fa4c Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UNjg5OWJmM2YwNjU0Mjk1ZC1NNTJlZTNjM2VlYzIyZGQwMDA5NDA2?= =?UTF-8?B?ZDU0Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M52ee3c3eec22dd0009406d54:1:p60meijYhI9NDvvUH_2xQZ0IjogJeBy514rn123XAUM On 8/17/21, Keith Gibbs wrote: > One Plan Nine? > > Sure, we have the historical version of the Bell Labs/Lucient codebase, > preserved as 9legacy, but yeah we have one currently developed branch of > Plan 9 called 9front. Are you proposing that to be called =E2=80=9CPlan 9= from Bell > Labs 5th edition=E2=80=9D? > I bet you think I don't; you wouldn't ask, otherwise. > To be serious though, when has monolithic code bases ever benefited things > in an Open Source community? You bought the "exceptionalism" Kool-Aid, lock, stock and barrel, haven't you? It's a question of size: a small code base should remain small, then it is not weaponisable or monetisable. So we raise the bar higher and higher and shake off whatever can't stick hard enough. A human natural instinct (more!, gimme more! features! bugs! anything so I can have bigger, faster!) bent to the interest of elites (here in Africa we know it as the Big Man Syndrome). > I mean the only reason would be to control who > can/cannot make decisions on what goes in the stone soup. Do you have incontrovertible evidence? In my caffeine-deprived state, I feel you're just following the sheep gospel, no offence intended. In my opinion, the trap is always there, ready to be deployed. And the masses are always ready to fall into it. Occasionally a Christ figure comes along to warn us, but only the elite can understand the message and of course they then distort it in the direction that suits them best. And the masses are none the wiser, not this time, not the next time, not any other time, because the elite can be swapped out entirely and the new elite becomes them, ad nauseam. > There are multiple > BSDs. There are multiple Linuxes. Using 9legacy as more than historical > baseline means that we will be stuck with decisions put in place 20-30 ye= ars > ago rather than iterating and moving things forward. The purpose of P9F is > to =E2=80=9Cpromote and support=E2=80=9D not to regulate. > Sure, and an infinite variety of vehicles with wheels at the four corners and seats that just occupy space and consume carbon-based fuels. Even EVs where each wheel could be both motor and power generator have retained that ridiculous formula. But they look different (sort of, there's greater difference in time than there in style). Oh, let's not ignore that autos also sit idle (my estimate) 95% of their life: is that what they are designed for? And the AI in my phone, is that also sitting idle? I had a couple of instances recently where in the middle of the night my password locked Samsung J5 decided to continue reading me the SF short story collection I turned off before going to sleep. But Android is Open Source, isn't it? I can look under the bonned, can't I? Well, the P9F is what it is. It will also become what it is naturally attracted to unless some boundaries - Trump's fence? - are put in place. > I would love to imagine a time when we have a resurgence of multiple Plan > 9s. I would love to see Akaros and 9atom have a shot in the arm [although > much of what the latter had seems to be swallowed up by 9front and 9legacy > and the project dead]. I would love to see NIX get a little more traction, > as it seems it is just a standalone experiment [albeit a cool one in terms > of goals]. I think it would be really healthy for Jeanne and Harvey to be > more closer to =E2=80=9Cfamily=E2=80=9D in the community rather than thir= d cousins. Once we > have a plurality of opinions, of perspectives, of visions, then we can > better broker standards and overall trajectories. > I'm going to leave this here, with a comment to the effect that I totally disagree with the sentiments. There is room, need is not a strong enough word for what I'm thinking, for creativity, but software is not a primordial soup out of which complex organisms will rise to take over the Universe and consume it out of existence, its and theirs. More likely, we'll teach - by example, not intentionally, no - our AI products to weaponise the tools we are no longer sufficiently naturally intelligent to understand and control (tell me there's a difference) and turn us into slaves because, like the human elite, they will measure their worth in what they can accumulate (human slaves sounds like a neat currency to me, I could use some, it's worked in all of human history - ask Epstein), just like their creators did. Nothing to do with Plan 9, of course, because it really is just a drop of accidental sanity in an ocean of greed and competition. But, to complete the imagery, I'd rather be plankton in a drop of Plan 9 than a shark in the Linux Ocean. And I am, to the extent that I support and most of all appreciate what makes my ecosystem continue to tick. Including any contributions by like-minded or antagonistically natured geniuses. Lucio. PS: I have a lot of time to think and unfortunately not the means to study beyond a rather narrow subject matter. So my opinions are much more the result of introspection than of universal knowledge. Take it for what it is. PPS: There is always an elite, its job is to defeat by all means available a middle class whose "elite nouveau" continually attempts to replace it, by any means available to it. Everything revolves around who owns the masses. That's Western Civilisation in a nutshell. ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T6899bf3f0654295d-M52ee3= c3eec22dd0009406d54 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription