From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.7 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: from tb-ob1.topicbox.com (tb-ob1.topicbox.com [64.147.108.173]) by inbox.vuxu.org (Postfix) with ESMTP id 71B4720232 for ; Wed, 15 May 2024 17:13:47 +0200 (CEST) Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id AAED92B3F9 for ; Wed, 15 May 2024 11:13:46 -0400 (EDT) (envelope-from bounce.mM2588816c321c02966ca52c27.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id A848315A95AF; Wed, 15 May 2024 11:13:46 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=BFHczSp6 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f54.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1715786026; bh=rTpiZX4eL3HWJUH0 yv1+HYuIJ2Ao9gNL+9fYsKG+B5E=; b=f6ebB5k5MTm1BrB8t4EP0kQNKxnYBANP +OdK9MnxJtjgzvlfSuR7hIwnNNDbEJKKnXLuhNCyfbvWmoFvp+kHXRx6wwsu1jN1 KHyniqBvqdFlpX8ReZcAzaE8jzbNA+wMj2xf0ahwZGXPsYTgfwCn1djThDbsmxbn fXyTIBXWpJQ= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1715786026; b=UHrknyReM7FtwaAfqX2pPjWHPdVdi+MDhoa8EE4CSVD50uIePC THhYg+6FuK6dadfngC07DUpFmRnCNFx6poX/vj6N+rRV9nrLAsEBQLnU27U0J0GJ v4qyb1f/Jv7JISzSoBTzWlMb9NOMKthf0kDdpWtg6GcGcclmQ3Gvq6y1Y= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=BFHczSp6 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f54.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=BFHczSp6 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.54 (mail-wr1-f54.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f54.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=L/6Nh39+; x-me-sender=none; x-ptr=pass smtp.helo=mail-wr1-f54.google.com policy.ptr=mail-wr1-f54.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1715786026; x=1715872426; bh=zrIAxTcIyWywzhyZ7W+UeCPp8W0gFOr3 wb0+q8XFjdA=; b=j299njIvpPh+zBXn+1xdNX7nsTd1fianam2WZWD0xgiU9Xp7 nyIHwnQq96bi2IfQ0ARq+p8CHTjbVLnE1ahbeEeey+Ajmc0NISV4zDVbPOTw8eyU 8ZDavLrDy725fw6JT4+VnlezfKbdFzr2jQp+456Z/k7p173g5ifg9pzAGRE= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 3B71415A8CCF for <9fans@9fans.net>; Wed, 15 May 2024 11:13:34 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id A4EE65FCDBA; Wed, 15 May 2024 11:13:34 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1715786014; b=ETlGY6/j9A0ucI20Owjd6Up1kKGPUTIRt/7rZoRE+JO98ZKPdZ yNe8oE3S+qP9ZrIKEzB5FIQO73X3Vn2QaSw+g4n1BIa2FmegjzVik3u80e00EKnZ ixpPI0Ou8JN62bzpkLfuTzjNGDpaNk0e3JamBH302sY+VruKBFztMbyF4ymLWukA 1QYzqhwJ9e1jb1tREKNO+AMGdhojfPzgD7pyDVcyFg8LpXU6/bLa7E4j1yhhl0XF CT/Kh4eQbw+bDKd/80l4B1KO6KxzMGCrQCrsuveqj0ocjMvs6L7NOd1QCPYTkat4 lArca7EB+Po6ezu/dLW1mqOQ0hm4uHzgrm9g== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1715786014; bh=Ku/mhWCOaK5SPSUsSaESuwoMawWW05E/e3na2kKwyv8=; b=WSviZfjgLjPh s/mDsU7LTonI+1JSeftq8pWzsfOR3sckaetZSbOlaQy4S9KmQshUYeLTBkv6KosS +gFb97l3Zv59FLCwDjvEV2oyjtBR2oxlXu1Zr5cFLcRGKHiD2wDv0R72+9/USljT mta6PvhBeTipGZiecxb97NEJptrQNzDQrKm1uw/e5c2HxgOvfj+XjLUIZC0PG23H kCxFDtbpBbxcxAMP68MnEpz6GCqCjlq2WM+bu5YJYouUWaQDBstE41+/KzOHb39+ gD2pQwYzMu8gIGdZOuMyDC/dKEznanE0V48fu+ftEMPjTIKW4TaaFwkZ/a6LrAzb ydXvj3950g== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=BFHczSp6 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.54 (mail-wr1-f54.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f54.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=L/6Nh39+; x-me-sender=none; x-ptr=pass smtp.helo=mail-wr1-f54.google.com policy.ptr=mail-wr1-f54.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvledrvdegkedgkedtucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf ffkffuvfgtsegrtderredttdejnecuhfhrohhmpefnuhgtihhoucffvgcutfgvuceolhhu tghiohdruggvrhgvsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpefhhedthe ffgedvfeduvdduhedvhfetfeehjeduvdehhfeghedugffgiedthfehffenucffohhmrghi nhepthhophhitggsohigrdgtohhmnecukfhppedvtdelrdekhedrvddvuddrheegnecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvvddu rdehgedphhgvlhhopehmrghilhdqfihruddqfhehgedrghhoohhglhgvrdgtohhmpdhmrg hilhhfrhhomhepoehluhgtihhordguvghrvgesghhmrghilhdrtghomheqpdhnsggprhgt phhtthhopedupdhrtghpthhtohepoeelfhgrnhhsseelfhgrnhhsrdhnvghtqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'lucio.dere@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="lucio.dere@gmail.com"; helo=mail-wr1-f54.google.com; client-ip=209.85.221.54 Received: from mail-wr1-f54.google.com (mail-wr1-f54.google.com [209.85.221.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 15 May 2024 11:13:33 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: by mail-wr1-f54.google.com with SMTP id ffacd0b85a97d-34d7d04808bso5316272f8f.0 for <9fans@9fans.net>; Wed, 15 May 2024 08:13:33 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1715786012; x=1716390812; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=Ku/mhWCOaK5SPSUsSaESuwoMawWW05E/e3na2kKwyv8=; b=L/6Nh39+DLHh2gw4cb8GkHG8zEXNC9084BIVeFGcrLlk9MuBSSfZ+BilbJq5YllIU0 Y2v7YUtRvLf6Ue815YHwfK9Kq9sxz10AbEHhHRa2/w3OGAXhgRYo2E0tp7ww0ZACwlXk digN+TsDquOjKYsZwLucuPqAwZS903/Wes1LlUNuYaRK9+jx1bISf+jNzfvYskOPCGr9 opRQtCGkHXOCnpKsfk59fNOw6Wnij8SDq7LFv9XM1hR0UMnBSZA07JPkzjHCXH19hdKX ml1trB4N3arCbUdUOc/ZwMPbw8IU2FtyrXngKBLhyFmMYjXHqLcrq2L6n58YuipUTZTh UR1w== X-Gm-Message-State: AOJu0Yz1rIUov4Nry1VS9q9sQ9s8UXbF3GY9ICpH3EzUhvQFNaP6g9RZ a2RVcyJfGAwm1F3aIUj84cGLiDdxBF0NVsoeiChL/OZd26KLtaH8Qwv8ZMdQWK+lBRjMeXtz/h+ 1NxOMxJHg1vuJMqfcCgjKkEGJchEf7w== X-Google-Smtp-Source: AGHT+IHna/RfmhpEWqVaSXnqf/KNmPO4+RiOaMyqfSbRzZvuyp6YOeoeRDxy+/+ygkUz6/CYoJZKP4HfHrccylRvyxY= X-Received: by 2002:adf:f10e:0:b0:34d:99ad:a536 with SMTP id ffacd0b85a97d-3504a61c75fmr15018368f8f.9.1715786011500; Wed, 15 May 2024 08:13:31 -0700 (PDT) MIME-Version: 1.0 References: <4FB3A3BB-1CFA-4BC7-9DC2-CC9138B8325C@gmail.com> <2ff4cb73-352f-44e1-844b-5bb6cc92e1fe@posixcafe.org> <04a0afc1-6440-47b3-957c-0071ad88b117@posixcafe.org> In-Reply-To: <04a0afc1-6440-47b3-957c-0071ad88b117@posixcafe.org> From: Lucio De Re Date: Wed, 15 May 2024 17:18:14 +0200 Message-ID: Subject: Re: [9fans] List of companies that use Plan 9. To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary=000000000000b9ea7c06187f8fb2 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: b5596b1e-12cd-11ef-98b1-6ba5058c7b06 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UYWQzZGMwYzkzMDM5YTdkMi1NMjU4ODgxNmMzMjFjMDI5NjZjYTUy?= =?UTF-8?B?YzI3Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M2588816c321c02966ca52c27:1:WUScf8nuzL0frXCwpFjPLUib2gUacSe1RyDtJww4eh0 --000000000000b9ea7c06187f8fb2 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable What makes you think I want Fossil back in 9front? I suggested that the sources could be included in the distribution, so they would not fork-rot as they are doing presently. It's always been the case that the Plan 9 distribution included "broken" sources that could not be compiled without external support, but were interesting enough to be published. That changed some when Alef was dropped and in fact I saved the Alef development stuff and ported it to 3ed and 4ed because I disagreed with the decision. Note that I made a sweeping generalisation, for simplicity, much was discarded between 2ed and 4ed, and I find all that quite regrettable. I am certain that Cinap had good reasons for removing Fossil, but I'm not sure you have painted the entire picture for this audience. No matter, of course, 9front will be what 9front will be. I'm not going to argue with the semantic subtleties of "bad" as you interpret it, but I will privately consider your judgement and interpret your postings with a bias parallel to the one you have displayed toward me so far. And I will not go away. Not by choice. Lucio. On Wed, May 15, 2024 at 4:37=E2=80=AFPM Jacob Moody w= rote: > On 5/15/24 04:02, Lucio De Re wrote: > > I have asked precisely NOTHING and have only pointed out the > consequences of omitting sources from the 9front distribution because it > leads to undesirable divisions. > > I'm just trying to correct the misinformation you stated. > When you call the decision to drop fossil "bad", your email reads as a > persuasive argument for why things should change. > I was in turn explaining why this is not happening, and if someone wanted > that to change what would need to happen. > > > > > I do find it tiresome that you keep ascribing intentions to me that may > well reflect precisely how YOU would feel and react in my position. I > assure I am nothing like that and I'm sure my history on 9fans for the pa= st > 20+ years would reflect that. But then again, people have abandoned 9fans > in the past for reasons not dissimilar from these; I can read the > undercurrent ("because you are asking for other people to maintain your > software for you for free"), I am not impolite enough to respond in kind. >=20 > Are your intentions not to persuade someone in the 9front world that > fossil is worth adding back to the system? >=20 --=20 Lucio De Re 2 Piet Retief St Kestell (Eastern Free State) 9860 South Africa Ph.: +27 58 653 1433 Cell: +27 83 251 5824 ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/Tad3dc0c93039a7d2-M25888= 16c321c02966ca52c27 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --000000000000b9ea7c06187f8fb2 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
What makes you think I want Fossil back in 9fr= ont? I suggested that the sources could be included in the distribution, so= they would not fork-rot as they are doing presently. It's always been = the case that the Plan 9 distribution included "broken" sources t= hat could not be compiled without external support, but were interesting en= ough to be published. That changed some when Alef was dropped and in fact I= saved the Alef development stuff and ported it to 3ed and 4ed because I di= sagreed with the decision. Note that I made a sweeping generalisation, for = simplicity, much was discarded between 2ed and 4ed, and I find all that qui= te regrettable.

I am certain that Cinap had good reaso= ns for removing Fossil, but I'm not sure you have painted the entire pi= cture for this audience. No matter, of course, 9front will be what 9front w= ill be.

I'm not going to argue with the sema= ntic subtleties of "bad" as you interpret it, but I will privatel= y consider your judgement and interpret your postings with a bias para= llel to the one you have displayed toward me so far.

=
And I will not go away. Not by choice.

Luci= o.

On Wed, May 15, 2024 at 4:37 PM Jacob Moody <moody@posixcafe.org> wrote:
=
On 5/15/24 04:02, Lucio D= e Re wrote:
> I have asked precisely NOTHING and have only pointed out the cons= equences of omitting sources from the 9front distribution because it leads = to undesirable divisions.

I'm just trying to correct the misinformation you stated.
When you call the decision to drop fossil "bad", your email reads= as a persuasive argument for why things should change.
I was in turn explaining why this is not happening, and if someone wanted t= hat to change what would need to happen.

>
> I do find it tiresome that you keep ascribing intentions to me that ma= y well reflect precisely how YOU would feel and react in my position. I ass= ure I am nothing like that and I'm sure my history on 9fans for the pas= t 20+ years would reflect that. But then again, people have abandoned 9fans= in the past for reasons not dissimilar from these; I can read the undercur= rent ("because you are asking for other people to maintain your softwa= re for you for free"), I am not impolite enough to respond in kind.
Are your intentions not to persuade someone in the 9front world that fossil= is worth adding back to the system?



------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/Tad3dc0c93039a7d2-M487e5306116b96ed7c5b70= 52
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription


--
Lucio De Re
2 Piet Retief St
= Kestell (Eastern Free State)
9860 South Africa

Ph.: +27 58 = 653 1433
Cell: +27 83 251 5824
= --000000000000b9ea7c06187f8fb2--