From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.7 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: from tb-ob1.topicbox.com (tb-ob1.topicbox.com [64.147.108.173]) by inbox.vuxu.org (Postfix) with ESMTP id 37CA421498 for ; Fri, 17 May 2024 19:32:50 +0200 (CEST) Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 402A02ED27 for ; Fri, 17 May 2024 13:32:50 -0400 (EDT) (envelope-from bounce.mMcee5e051d9e2b4e4696d1b06.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 3D6A218F1B76; Fri, 17 May 2024 13:32:50 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=EcENXub2 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f51.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1715967170; bh=OgA8FpImQlV5ZE6v ahwxmGx4IEJ3EhjzuUUTrox3sAU=; b=O+pO2RFS3AL6ORasKr7Anzbj2/gzxcGA L4tNxk/J4qweJUzDC9xKeemCpwF7ODoUSNNZXWzFZkNZN16h/jcFxkNhEZRpPVZr B0xOw3tEiAbzpAUJj5IazUjZ0AgYRA1SPksc8YE9pC2hpZbie5SUhV8H6nBeWpFe fiTAk2E2qwU= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1715967170; b=BcX7WwAvr04TFdSjiDZG1s7vhZKNwI2EgoYJTmvP/vbukKyAD5 o5cUTnVQRVvyDMNX1bQ83IN+RCSzR3BAb0aymksvo3YZDuqBBtCxx5CYUa+OF9iy VsYJxfQXo9NwropPoariEs/dywMAJunvICwm9phOSOCbdoZWMPqEGUUK0= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=EcENXub2 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f51.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=EcENXub2 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.51 (mail-wr1-f51.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f51.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=vOVXoe+V; x-me-sender=none; x-ptr=pass smtp.helo=mail-wr1-f51.google.com policy.ptr=mail-wr1-f51.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1715967170; x=1716053570; bh=Pr2XwOhuQIUuc4tCxs03uAWqkja/Gopv XrX7vpF0wis=; b=nbGo77i8C+8rvJC9RtMghiIdg5j3gcORGyNVAIXV09cfXZce ERXto3MEJd05tANq94pX1lHwcCku6j/r2ywycfiis1Zkgq3164PqdsgDKcOkZCeR DusHAfS3eefyc47t/no2OcOPnbmSdLy8WCyT0Efzs+2G/YZ6ArvxZCc7mzs= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 6B1D619B2FE2 for <9fans@9fans.net>; Fri, 17 May 2024 13:32:39 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 685C669CFA9; Fri, 17 May 2024 13:32:39 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1715967159; b=AuPzxLNZOrz+DfHU+Mwzk34PTfUQ6/mIrk7GgpT0yyhc9xINGE wj55OOtMxBKiDl6sw9kJh6iCqNFDCgGmFJ4X21ZhOhZb6cb+JC9V5knQ+uWZYULx kwcfTTCBha9fw2aMwgS+EGenNYzPHt/LBZMVhiWORVCCp+FL8RSryPmYQxPno6aH ehedMSw/Rrm1MBskz/Mxa6UiVkTiXWrZfmGHOA8v5OVYl6XD1HaSEIE9ef+MAgzA uqWXQU0q3FI2mZIxYhzJmZRyORovY3pRJ//6LTAKmvGknVbIrL06HX1AibSd2BNU wxxC4Ed0BEyiAlJds4ODFb/CSXpPNfJVnc4g== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1715967159; bh=RujysxUUduuIm/k6ImKpcXROVtVcQvIW3M4wYPXnoaQ=; b=y0AhJeQnY6hA 5sNJAI/Zf0O/omTDLmuZPb4ifoBzM28daziovWoIfUfzDgr6MJthN8UF7z+Xul4z BJIYr+bKwf5kFgH8rlhH5sf6tBjm+Ns+R34vNAQy/SrGzGQds4hgeF+OgtST+UTC Rpkvx9kjDHZiKyf0QLc8WTi1vRXFchPJ7BkGH1tEYS+wvV0N+8FeQUA0VmtDb/u/ /dSsfgkBtNTuRtqn/64TrIa6WIT1dXfDFSx1h2paas/GJs85nb+vG91/oqhu+vGS POJO1XxuqfauL+jH9RwUL6nZDc57QEvKg5AzY8pjLQEMyp1XVIA+8jwepdDSziRJ ul6t5v+IRg== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=EcENXub2 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.51 (mail-wr1-f51.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f51.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=vOVXoe+V; x-me-sender=none; x-ptr=pass smtp.helo=mail-wr1-f51.google.com policy.ptr=mail-wr1-f51.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvledrvdehgedgvddtucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf ffkffuvfgtsegrtderredttdejnecuhfhrohhmpefnuhgtihhoucffvgcutfgvuceolhhu tghiohdruggvrhgvsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpefhhedthe ffgedvfeduvdduhedvhfetfeehjeduvdehhfeghedugffgiedthfehffenucffohhmrghi nhepthhophhitggsohigrdgtohhmnecukfhppedvtdelrdekhedrvddvuddrhedunecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvvddu rdehuddphhgvlhhopehmrghilhdqfihruddqfhehuddrghhoohhglhgvrdgtohhmpdhmrg hilhhfrhhomhepoehluhgtihhordguvghrvgesghhmrghilhdrtghomheqpdhnsggprhgt phhtthhopedupdhrtghpthhtohepoeelfhgrnhhsseelfhgrnhhsrdhnvghtqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'lucio.dere@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="lucio.dere@gmail.com"; helo=mail-wr1-f51.google.com; client-ip=209.85.221.51 Received: from mail-wr1-f51.google.com (mail-wr1-f51.google.com [209.85.221.51]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 17 May 2024 13:32:38 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: by mail-wr1-f51.google.com with SMTP id ffacd0b85a97d-351ae94323aso284113f8f.0 for <9fans@9fans.net>; Fri, 17 May 2024 10:32:38 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1715967157; x=1716571957; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=RujysxUUduuIm/k6ImKpcXROVtVcQvIW3M4wYPXnoaQ=; b=vOVXoe+VnHDaX+ioRnX+BWvA7MaOzzH9l0qBI+ssB+2We18g2sTNJ0trNvkc35jj6q IEKJr7H6087l9GTq3Lr1i4ywyHskocd82v0Du9uzm3eU6eqYvsjFkoRdNmZRt3dsCmOp +CYYwVat5yTybjRk1++RqMZSYm5CIhnth9ETD9OIrKUpAumcQXT93DuuzL/BnVEZE6ah RKvmS/IfmG+fkJSb3JRF5o9LVcburopbp/lJiBk4MZsyyZJQZpu9FxaoAPORtqeOP6N1 kfMMi2ul8o+hJtWDpBJXMoOEKidGGuSEAA492bjl06XT5zugV8Ni9jMCueMpJzz/7BEM Az+Q== X-Gm-Message-State: AOJu0YxjX4+W3hygLJljE26UStpkJcgOCARLEclZ8fjlqYSkCVkpkFas yxmJMXwgnEnFWr+aS3EWmDrlozZUc/JN+g7Dk0hiYuDUBvBcvlc0UPEIgnLAx7huJfJ7eDeYiXh 0paOqtxcgX+sj5kOEmzB+1fSukvugdoYx X-Google-Smtp-Source: AGHT+IEsSWOyPvNIMgmvkynUv0PxQep/g3a7oLd0p7A+WjpLPnVVmVA9HziLooBVQlSnGa+LsZrmQicAJJ3ONVntnlU= X-Received: by 2002:a05:6000:150:b0:34d:99ac:dcd0 with SMTP id ffacd0b85a97d-3504a968a10mr14901976f8f.49.1715967156848; Fri, 17 May 2024 10:32:36 -0700 (PDT) MIME-Version: 1.0 References: <4FB3A3BB-1CFA-4BC7-9DC2-CC9138B8325C@gmail.com> <2ff4cb73-352f-44e1-844b-5bb6cc92e1fe@posixcafe.org> <04a0afc1-6440-47b3-957c-0071ad88b117@posixcafe.org> In-Reply-To: From: Lucio De Re Date: Fri, 17 May 2024 19:37:23 +0200 Message-ID: Subject: Re: [9fans] List of companies that use Plan 9. To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary=000000000000d497c10618a9bce0 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 7817913e-1473-11ef-aaaa-c039bdb86c71 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UYWQzZGMwYzkzMDM5YTdkMi1NY2VlNWUwNTFkOWUyYjRlNDY5NmQx?= =?UTF-8?B?YjA2Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:Mcee5e051d9e2b4e4696d1b06:1:i5sCfDcxS418gLMUvGrKflwJ1ntJVQDv1edAjuWdWpc --000000000000d497c10618a9bce0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable "I have a branch of 9front with fossil restored. I have discussed what would be needed to add fossil upstream again, and there was acceptance to the possibility if the issues get worked out _first_." I took the Fossil sources from whatever was the most readily available distribution and after locating a single duplicated constant (56 * 1024 on one hand and 64 * (2<<10) on the other, I hacked one away), Fossil compiled on 9front without a hitch. Good enough for me to feel I can use it to rescue my "precious" data. My fear was that I would not be able to afford such a rescue if it got much more complex than that. So let's put to bed any delusion that I want Fossil included in 9front, I was quite satisfied with protestations that something no worse than the 9legacy version was in fact available with minimal effort. On the other hand, I am disappointed that the door unlocked by Venti and barely held ajar by Fossil may slam shut to 9front users and to that end I am going to make a new request. Now this is not an "or else" request, nor a promise, merely a wish based on comments in this forum to the effect that failures have been identified in Fossil (and Venti, too). If such a list already exists, that would be extremely welcome (to me, at least). If not, perhaps a summary of the type of triggers that cause failures would be helpful, at least as much as knowing who are the most knowledgeable developers in connection with this aspect. If all that's available is some hazy description, well, that's perfectly OK, if disappointing. Maybe for someone like me that will turn out sufficient to continue Fossil/Venti development. It's tempting to point out that trying to compete with 9front developers would be a mug's game, so not including a version of Fossil/Venti that can be successfully compiled and deployed is not going to handicap any 9legacy development. Again, none of the above is intended to cast aspersions on anyone. I reserve my opinions on the emotional undercurrents in the discussions that are still taking place here, but the value of the emotional baggage involved, in my opinion, is precisely zero, even though I have had quite a few occasions for muttering and even cursing into my beard (or is it under my breath?). Lucio. On Fri, May 17, 2024 at 6:53=E2=80=AFPM Noam Preil wro= te: > I have found multiple deadlocks over the last few years, and only > bothered fixing one of them. That patch is in 9legacy, as well, now. >=20 > During my IWP9 talk in which, among other things, I explained why I > intend to replace fossil despite curently using it, I demonstrated one > of the problems with fossil by (attempting to) install Go, which crashes > the file system _every single time_. >=20 > I personally fixed over a dozen issues in Venti, and continue to find > more. To the best of my knowledge, those patches are currently _only_ > present in 9front. I was not aware 9legacy existed when I did that > work. >=20 > I've lost some data to fossil crashes, since if it e.g. loses power > during a sync, it will end up _erasing_ a file rather than preserving > the old version, which has _broken boot_ if the system crashed while I > was editing lib/profile. >=20 > I have a branch of 9front with fossil restored. I have discussed what > would be needed to add fossil upstream again, and there was acceptance > to the possibility if the issues get worked out _first_. >=20 > The hostility on this list is pervasive and comes from all sides. If > your goal is positive engagement, this is not the place to do it. >=20 --=20 Lucio De Re 2 Piet Retief St Kestell (Eastern Free State) 9860 South Africa Ph.: +27 58 653 1433 Cell: +27 83 251 5824 ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/Tad3dc0c93039a7d2-Mcee5e= 051d9e2b4e4696d1b06 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --000000000000d497c10618a9bce0 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
"I have a branch of 9front with fossil re= stored. I have discussed what
would be needed to add fossil upstream a= gain, and there was acceptance
to the possibility if the issues get wo= rked out _first_."

I took the Fossil sources from= whatever was the most readily available distribution and after locating a = single duplicated constant (56 * 1024 on one hand and 64 * (2<<10) on= the other, I hacked one away), Fossil compiled on 9front without a hitch. = Good enough for me to feel I can use it to rescue my "precious" d= ata. My fear was that I would not be able to afford such a rescue if it got= much more complex than that. So let's put to bed any delusion that I w= ant Fossil included in 9front, I was quite satisfied with protestations tha= t something no worse than the 9legacy version was in fact available with mi= nimal effort.

On the other hand, I am disappoint= ed that the door unlocked by Venti and barely held ajar by Fossil may slam = shut to 9front users and to that end I am going to make a new request. Now = this is not an "or else" request, nor a promise, merely a wish ba= sed on comments in this forum to the effect that failures have been identif= ied in Fossil (and Venti, too).

If such a list a= lready exists, that would be extremely welcome (to me, at least). If not, p= erhaps a summary of the type of triggers that cause failures would be helpf= ul, at least as much as knowing who are the most knowledgeable developers i= n connection with this aspect. If all that's available is some hazy des= cription, well, that's perfectly OK, if disappointing. Maybe for someon= e like me that will turn out sufficient to continue Fossil/Venti developmen= t. It's tempting to point out that trying to compete with 9front develo= pers would be a mug's game, so not including a version of Fossil/Venti = that can be successfully compiled and deployed is not going to handicap any= 9legacy development.

Again, none of the above i= s intended to cast aspersions on anyone. I reserve my opinions on the emoti= onal undercurrents in the discussions that are still taking place here, but= the value of the emotional baggage involved, in my opinion, is precisely z= ero, even though I have had quite a few occasions for muttering and even cu= rsing into my beard (or is it under my breath?).

Lucio.

On Fri, May 17, 2024 at 6:53 PM Noam Preil <noam@pixelhero.dev> wrote:
I have found multiple d= eadlocks over the last few years, and only
bothered fixing one of them. That patch is in 9legacy, as well, now.
<= br /> During my IWP9 talk in which, among other things, I explained why I
intend to replace fossil despite curently using it, I demonstrated one
of the problems with fossil by (attempting to) install Go, which crashes the file system _every single time_.

I personally fixed over a dozen issues in Venti, and continue to find
more. To the best of my knowledge, those patches are currently _only_
present in 9front. I was not aware 9legacy existed when I did that
work.

I've lost some data to fossil crashes, since if it e.g. loses power
during a sync, it will end up _erasing_ a file rather than preserving
the old version, which has _broken boot_ if the system crashed while I
was editing lib/profile.

I have a branch of 9front with fossil restored. I have discussed what
would be needed to add fossil upstream again, and there was acceptance
to the possibility if the issues get worked out _first_.

The hostility on this list is pervasive and comes from all sides. If
your goal is positive engagement, this is not the place to do it.



------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/Tad3dc0c93039a7d2-Me721f99709008ac03b77ea= 0b
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription


--
Lucio De Re
2 Piet Retief St
= Kestell (Eastern Free State)
9860 South Africa

Ph.: +27 58 = 653 1433
Cell: +27 83 251 5824
= --000000000000d497c10618a9bce0--