From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.7 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: from tb-ob0.topicbox.com (tb-ob0.topicbox.com [64.147.108.117]) by inbox.vuxu.org (Postfix) with ESMTP id 0BC7425195 for ; Wed, 8 May 2024 18:02:51 +0200 (CEST) Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 4460123237 for ; Wed, 8 May 2024 12:02:50 -0400 (EDT) (envelope-from bounce.mM4fdf7b4cd151312886fd01db.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 3E5D6189922C; Wed, 8 May 2024 12:02:50 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=fKVr8IZ1 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f54.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:from:date:message-id:to :content-type:list-help:list-id:list-post:list-subscribe :reply-to:subject:content-transfer-encoding:list-unsubscribe; s= sysmsg-1; t=1715184170; bh=uRLihpbxpxi11/ZR70lur3LZKvP/1HDby5zZk +qRrPc=; b=C2+SCBIO1ZrJpRxjb//qoIdCrH2eZet0fpo9urzn5FajRO8DCGafT uN1M+uzE1ukYLYyiK4M1gjahufeU7gO4JG/rwwOiQPzI22dNjBp4WNyTV5VObt4n borBdWbHFU8aeANWzO9ECn70DRLbsFPqN6ACxxBsb+x39cNVNu36D0= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1715184170; b=gD5VzUXoUUUvTphKjfF/HWig0dxBusDwfakpdhGobhAqqMcoQZ JIOnBeyp8L7B03wtQU3SPQl9E6oryz/rRktwGmLRPur/+qiXOmgdxb5Ff29CFeOb YngBexQaOiAJ2FNUJFl7Jqa/VWM5scu6qNTxvsglSo/prGMN1/yAw59Hw= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=fKVr8IZ1 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f54.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=fKVr8IZ1 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.54 (mail-wr1-f54.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f54.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=lJrn/8Y9; x-me-sender=none; x-ptr=pass smtp.helo=mail-wr1-f54.google.com policy.ptr=mail-wr1-f54.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-100 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:from:date:message-id:to:content-type:list-help :list-id:list-post:list-subscribe:reply-to:subject :content-transfer-encoding:list-unsubscribe; s=dkim-1; t= 1715184170; x=1715270570; bh=U2GbX+fPmoFuABT6w4a2An9uKtWaL48AMVF DcBY5ERk=; b=dFoYnnAraZCnsuwQBeyDY1JQ7Ceni6Dq6dItbceFTcYkkD+/f6Y jI3DmhvSnfuY87sTsdrHBBchZ+Z81mi2qQPKS3h21uMq6C1f4vvmOxrEYnN/reGG oVrzO76TGmcQPWWZRUYnJT7kqDGux4NdozDlUiZ7tbTNeE+82L5UGRt4= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 13A9917D74C5 for <9fans@9fans.net>; Wed, 8 May 2024 12:02:30 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 6A8D8729C28; Wed, 8 May 2024 12:02:30 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1715184150; b=YcNrnhVwd0tjXVpVDkseqMUzzVZM9K/xhLsPrsmQ27Q9FkOMLz FIjc/fk1Uj6/ru/3ZydktOZM+9pmBGXyqe+CWWtrtyTGOdeasKthjAXwtXGAYwTy BfJziUR/3bwwWjxN6VRc9iVi5x29dM15vxOkh224AcIGPk6nSnmuUWaU5+GsUzf0 CPkZ9cAsqPFlg4wmS1OoZ9es2blo/UIV+IPmw1dmRKGh3Be8X6MjMFyge4Bp5J/k X8HdLtSOUBxcfpnXeuFywrPdmCJMlYFcy1MWvf88cmsHLBXnQKmZkYS4H/PdtrUW BaRh5QqJu/8Fd/nvNv6t1LxLjfli+0GDaekw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:from:date:message-id:subject:to :content-type; s=arcseal; t=1715184150; bh=sweJwf566PjYnqC5q11Dm FUuFpI6fxy2IpxkomJfFEY=; b=aHwWdxO/8zfYoe/bNI4oUKIqwRX6dmwh3i3DL 63eLqyayVge77uq/F/x+r0e0UPb6mZcKxUtRv7yChXfLkNb4BLDmr9M7K0AhtjhS ppKobuaiwSr3QANojAdYs46ht54HHMy7LBmaPyngcG59RZeUAmLTuq8UYNt7fCir lwgrPVb3DEzWWrJw9QvP1nv28VnkUvQgze8ap4nzyFbdi8Y3NaC5QQhyFmqt3Fw4 WOCbpzODIb4KGJ7+Xr831L94WjPigF2T85MjGV7GkdiKfja/wAVPgVq3KrARXmlr EQn1jRBW93hK5fFzVG14qCNRIDn4cl8KQSFdk5rU01Z5Sty/w== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=fKVr8IZ1 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.221.54 (mail-wr1-f54.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wr1-f54.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=lJrn/8Y9; x-me-sender=none; x-ptr=pass smtp.helo=mail-wr1-f54.google.com policy.ptr=mail-wr1-f54.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-100 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvledrvdeftddgleegucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepggfhfffkuffvtgesrgdtreertddtjeenucfhrhho mhepnfhutghiohcuffgvucftvgcuoehluhgtihhordguvghrvgesghhmrghilhdrtghomh eqnecuggftrfgrthhtvghrnhepheehffetvefgteeifffhtedutdegheejtefhfeejuedt kefhveejueejheevheefnecukfhppedvtdelrdekhedrvddvuddrheegnecuvehluhhsth gvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvvddurdehgedp hhgvlhhopehmrghilhdqfihruddqfhehgedrghhoohhglhgvrdgtohhmpdhmrghilhhfrh homhepoehluhgtihhordguvghrvgesghhmrghilhdrtghomheqpdhnsggprhgtphhtthho pedupdhrtghpthhtohepoeelfhgrnhhsseelfhgrnhhsrdhnvghtqe X-ME-VSScore: -100 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'lucio.dere@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="lucio.dere@gmail.com"; helo=mail-wr1-f54.google.com; client-ip=209.85.221.54 Received: from mail-wr1-f54.google.com (mail-wr1-f54.google.com [209.85.221.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 8 May 2024 12:02:29 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: by mail-wr1-f54.google.com with SMTP id ffacd0b85a97d-34c8592b8dbso3470735f8f.3 for <9fans@9fans.net>; Wed, 08 May 2024 09:02:29 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1715184148; x=1715788948; h=to:subject:message-id:date:from:mime-version:x-gm-message-state :from:to:cc:subject:date:message-id:reply-to; bh=sweJwf566PjYnqC5q11DmFUuFpI6fxy2IpxkomJfFEY=; b=lJrn/8Y9KrunTaqDSq5XlbLLhMkcKUcFfXlnXjau83d2HvCkdvH10UFAt04ySDgT2o Nf1OpuZLZprrGn6ZNC0b2bApPFxDQ/quzpwlmLj9+5kyLjd/QcwFc5ZSHBOuYIpf6NJh E8PKu8t7mrXa8hVirTkbZyfx/d5IMcaJiYmHmklh4xRI4fCf4oRKURGOI7CckbTCAz6j 69wdFxRREItMaa3ow6u4eDKAemLizkiK8oCDNMdQ9Rir+vbt4BwtG9J2E3iSdhe5d0n4 BcUgzLQiJHoOCy9razuX37oSanI2rl8rC+NVLrkxkSuj22giEWg0VL9TZQSH9useBjM+ B+BQ== X-Gm-Message-State: AOJu0YzhmpoXmcJfJbBU4f+L5UGoEcggDU2Ywsw3N8fe5KyM8+H0BBQD IgT+jL/qpC+4HJZo6wJzFaFB23DxCT3oNe76Zssok4Cc+NtSiBgrlD+szUJAlTymDydjeZOD/f4 hngjGZcZF7tzmpVBGNZnl40fFO0Pjlw== X-Google-Smtp-Source: AGHT+IEgqzPCA6hHgz/O4zL462J4IMJg+Yijs56r46wGjOrFJUXQ+0FiVH/v6iQIAkx1NuIXf7a+3Z6eBrs/78jf8Aw= X-Received: by 2002:adf:dd88:0:b0:34d:e262:8b54 with SMTP id ffacd0b85a97d-34fca054a29mr2671500f8f.7.1715184147563; Wed, 08 May 2024 09:02:27 -0700 (PDT) MIME-Version: 1.0 From: Lucio De Re Date: Wed, 8 May 2024 18:06:58 +0200 Message-ID: To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Content-Type: multipart/alternative; boundary=000000000000d70d9b0617f36d35 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 62683300-0d54-11ef-852d-b13f018c7b06 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UZGUyY2EyYWRkYTM4M2EzYS1NNGZkZjdiNGNkMTUxMzEyODg2ZmQw?= =?UTF-8?B?MWRiPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Subject: [9fans] Interoperating between 9legacy and 9front Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M4fdf7b4cd151312886fd01db:1:JCU26C2wRRA4n-hli2RiXZVXLGFV7PjuhlQnX7f07I4 --000000000000d70d9b0617f36d35 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable There is much I would like to explain, but the problem I am attempting to solve ought to have an obvious answer that I am clearly missing. I can't seem to get a 9front workstation to mount a networked 9legacy fossil service. The FS is a fairly pristine 9legacy installation, on a somewhat old 386 platform. I did need to tweak various parameters on both side, but eventually I got to the point where both hosts declare that the connection has been established; now on the 9front workstation I get the message "srv net!192.96.33.148!9fs: mount failed: fossil authCheck: auth protocol not finished" I suspect the culprit is the lack of the newer "dp9ik" security on 9legacy, in which case it would be helpful to know how to work around that. Why am I mixing my platforms like this? Because the hardware on which I am attempting to recover a rather large historical file system is split between IDE and SATA and I have no hardware that can handle both disk modes and I need to move information between the two media types. I am not describing all the dead ends I tried, incidentally, that would take too long and really expose my limited understanding. It took almost a day to copy the Fossil cache (or lose a lot of the most recent changes) and now I need (or at least want) to update the default boot ("arenas") Venti configuration on a SATA drive which I can only access on hardware I can't install 9legacy on. It's complicated and I'm sure there are people here who would not find this so daunting, but that's where I am at. To be precise, I need to change the Fossil default configuration (in the "fossil" cache) so it points to the correct Venti arenas. I'll deal with the analogous Venti situation when I get past the total absence of Fossil tools on 9front. I guess I can port fossil/conf to 9front, but I'm not sure I have the stomach to try that. Maybe now that I have raised the possibility... I managed to share the Fossil cache through a NetBSD server providing u9fs services, but that host does not have the capacity to store the Venti arenas, nor can I really justify spending the amount of time it would take to pass it between the 9legacy and 9front devices via NetBSD, no matter how I try to arrange that. It does baffle me, though, that a NetBSD intermediary is more competent than the two "native" platforms. I must admit I got to know nits in these two distributions that I would rather I didn't have to, but I've just about had enough. --=20 Lucio De Re 2 Piet Retief St Kestell (Eastern Free State) 9860 South Africa Ph.: +27 58 653 1433 Cell: +27 83 251 5824 ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/Tde2ca2adda383a3a-M4fdf7= b4cd151312886fd01db Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --000000000000d70d9b0617f36d35 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
There is much I would like to explain, but the= problem I am attempting to solve ought to have an obvious answer that= I am clearly missing.

I can't seem to get a 9fron= t workstation to mount a networked 9legacy fossil service. The FS is a fair= ly pristine 9legacy installation, on a somewhat old 386 platform. I did nee= d to tweak various parameters on both side, but eventually I got to the poi= nt where both hosts declare that the connection has been established; now o= n the 9front workstation I get the message
    "sr= v net!192.96.33.148!9fs: mount failed: fossil authCheck: auth protocol not = finished"
I suspect the culprit is the lack of the newer &qu= ot;dp9ik" security on 9legacy, in which case it would be helpful to kn= ow how to work around that.

Why am I mixing my p= latforms like this? Because the hardware on which I am attempting to recove= r a rather large historical file system is split between IDE and SATA and I= have no hardware that can handle both disk modes and I need to move inform= ation between the two media types. I am not describing all the dead ends I = tried, incidentally, that would take too long and really expose my limited = understanding.

It took almost a day to copy the = Fossil cache (or lose a lot of the most recent changes) and now I need (or = at least want) to update the default boot ("arenas") Venti config= uration on a SATA drive which I can only access on hardware I can't ins= tall 9legacy on. It's complicated and I'm sure there are people her= e who would not find this so daunting, but that's where I am at. To be = precise, I need to change the Fossil default configuration (in the "fo= ssil" cache) so it points to the correct Venti arenas. I'll deal w= ith the analogous Venti situation when I get past the total absence of Foss= il tools on 9front.

I guess I can port fossil/co= nf to 9front, but I'm not sure I have the stomach to try that. Maybe no= w that I have raised the possibility...

I manage= d to share the Fossil cache through a NetBSD server providing u9fs services= , but that host does not have the capacity to store the Venti arenas, nor c= an I really justify spending the amount of time it would take to pass it be= tween the 9legacy and 9front devices via NetBSD, no matter how I try to arr= ange that. It does baffle me, though, that a NetBSD intermediary is more co= mpetent than the two "native" platforms.

I must admit I got to know nits in these two distributions that I would = rather I didn't have to, but I've just about had enough.

--
Lucio De Re
2 Piet Retief St
Kestell (Eastern Free Sta= te)
9860 South Africa

Ph.: +27 58 653 1433
Cell: +27 8= 3 251 5824
= --000000000000d70d9b0617f36d35--