From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.7 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: from tb-ob1.topicbox.com (tb-ob1.topicbox.com [64.147.108.173]) by inbox.vuxu.org (Postfix) with ESMTP id 85E7426F2D for ; Wed, 15 May 2024 19:32:20 +0200 (CEST) Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob1.topicbox.com (Postfix) with ESMTP id A14952FB62 for ; Wed, 15 May 2024 13:32:19 -0400 (EDT) (envelope-from bounce.mM306a6ee417e8e91c0c9e01a7.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 9851E1972ED1; Wed, 15 May 2024 13:32:19 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=nWeUHXHY header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wm1-f44.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1715794339; bh=LRjmD4VqfiRbxNVy hGwl//BwcHeZ+hoEd5kwyxvw3to=; b=tAFhMo6e9lAM5Yg3eIwSBlcY6bNz2nlM agdD6vxnVdprMISUEtPPOwcqV40ftgc/FF4h98CvxfzGw4rQVOas+okIH5+iAW2w IR75xxdITzvpIifEiuIp5hmv8o3MGi98uonOl7/c/8RBkN45miF/u7LdveSWaFyl Wutz0OCCmqc= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1715794339; b=SseqkVxJFVXLM+tUyOxCxOeSu87Z4LFH4zK0Xr3MCXN0sVOjja J+VWqhjEF8gucPkHJ+6/+0ppi/KoYu6YYY7t0TAHtX8tzaepOKVpuDCqzwtjWIqj aMWOrwjbvWXGS4ZrAIZzCl0ZOR6j/nbtTbcFL3ukbGbFkn6kex/1zSw5Y= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=nWeUHXHY header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wm1-f44.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=nWeUHXHY header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.128.44 (mail-wm1-f44.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wm1-f44.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=lLs62GYO; x-me-sender=none; x-ptr=pass smtp.helo=mail-wm1-f44.google.com policy.ptr=mail-wm1-f44.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1715794339; x=1715880739; bh=renjwQqek3WYk/2wxS/Jaf5JQvAEq05X HUob/PwiVo0=; b=Ohzutd0uOLNQD6zR4rmav+dmTioEjCJLDtpJfZCh+HoaYB4d f+yD5WAzFc6KmBxC3c2W2kqBoDwVfdbjN9+RZ8G0F0UjQUEAxhXQau1WRxcDMkKL EfNrcBk0aExLf98Ajo16/5rsBq1oDq+l8jHBoWVNaIuatfx/7XlGZJ9UZIQ= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id DB4C4306057A for <9fans@9fans.net>; Wed, 15 May 2024 13:32:06 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id C631408CF7F; Wed, 15 May 2024 13:32:06 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1715794326; b=F1vdtpwuZF0oOrbicV3IxSECfkJb9ArZ4OnfMuxvruA3BiC2I6 b+AReAh9gJMUhYZo1eSWr9jPvNbItYD7/zegAUSq8sNPru/twgo29KhgyZcaWgKh QSnZVU5fOpQojxA9ULnZ2/krSa85xShSJv/4/fpX+vu0Z6qkOLlbaxj3mtHn7lhj trDTP7L8afP5o63Pqbu3ruDRnGw6FeJzKCOD//GLdxGO1KkyvPEY3ZeWwHnMy/5m foTRq6KkjfFXXMXxJdBE4NjuDYyrMtbWMg9i4ApvEL/3Y1akHcYhJ67KAhWifIDO 28EYYb/kaeVtZleXARdFmq98aoLYlJUBUF2Q== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1715794326; bh=jtHR91eUT44LT0WyJRLU5utlM2pRGomoTo7h5yf78k4=; b=sNsqGmJc47To lsFdKIOMNbjAHCRbgcGt5s5ZuTER4ikprKBXcC28gjC3/p2tDRbKymNqSgO4bU/M 9mGtL4cOZIAO2Msym3VplTpjLJOBOzq8vEX4iMaesq55cDHnnqjaOKZOZlY/Ajpt a+SufGHO+neCoXHLA1zN+mqhJYVtpDZIXw6nlB7zCdjsj8KksTTI1tCXoMfydyEv st4K3SKm50jyQ6zirKyKcw/EalD91rfTTJjwHRi2/GvTXN0RsuWFuazJ+v8oNEne ANx5h4MGzD7pie8PF1hY35gFG1v2hagw0vhYkBD2X8c8dkckUCLVcrB7Ptmh2nbq 4SRSVHOEYg== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=nWeUHXHY header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.128.44 (mail-wm1-f44.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-wm1-f44.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=lLs62GYO; x-me-sender=none; x-ptr=pass smtp.helo=mail-wm1-f44.google.com policy.ptr=mail-wm1-f44.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvledrvdegkedguddtlecutefuodetggdotefrod ftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdp uffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecunecujfgurhepgghfjg fhfffkuffvtgesrgdtreertddtjeenucfhrhhomhepnfhutghiohcuffgvucftvgcuoehl uhgtihhordguvghrvgesghhmrghilhdrtghomheqnecuggftrfgrthhtvghrnhephfehtd ehffegvdefuddvudehvdfhteefheejuddvhefhgeehudfggfeitdfhheffnecuffhomhgr ihhnpehtohhpihgtsghogidrtghomhenucfkphepvddtledrkeehrdduvdekrdeggeenuc evlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedruddv kedrgeegpdhhvghlohepmhgrihhlqdifmhduqdhfgeegrdhgohhoghhlvgdrtghomhdpmh grihhlfhhrohhmpeeolhhutghiohdruggvrhgvsehgmhgrihhlrdgtohhmqedpnhgspghr tghpthhtohepuddprhgtphhtthhopeeolehfrghnsheslehfrghnshdrnhgvtheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'lucio.dere@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="lucio.dere@gmail.com"; helo=mail-wm1-f44.google.com; client-ip=209.85.128.44 Received: from mail-wm1-f44.google.com (mail-wm1-f44.google.com [209.85.128.44]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 15 May 2024 13:32:05 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: by mail-wm1-f44.google.com with SMTP id 5b1f17b1804b1-4200ee47de7so32144585e9.2 for <9fans@9fans.net>; Wed, 15 May 2024 10:32:05 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1715794324; x=1716399124; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=jtHR91eUT44LT0WyJRLU5utlM2pRGomoTo7h5yf78k4=; b=lLs62GYOsXWNj6lwWG4gmaY+PTzaSsDSAaQ3dqdObYcTBXa317ZUsCQ7zweLkvLqtm YHETCxqTvHiFlm9kdlahTelRY9cDyorWXtu2ORj+cGNARe+Ir/JaRT7WpbDEB/NDakfK rX7F1iz8J8dwntcrO73imbrChjG2Tw3lvXhlMrWb7tbri8OrDTJ150doVjK2fTMHoEgr OoLMu6XwaUTjI3ZZKtujgumRFTZvqxKvoUOtfInVuEx7BAuqn6c6GHHvE/4IJPuYUiM1 D4maBFrt+AlSJKouSf5CCmnzbZu6nR5ZVoBaWZrluRG82n7GZ10HOlHMdVS63fn1nJ4u F/0A== X-Gm-Message-State: AOJu0Yza7QhKFbWe9UDGMX96hc7e+S99QR6x33qrLXV/ZCTV5l659Ij9 NRpbndF8FqncqnBmT8Vf9VsLzKR9ewje9hOLeYf5qCQpC+qcG05nND/hmXStohdmfUzKev7Uxe2 MH5g2jB10oayESQ39IwygC7m0+o7wWQ== X-Google-Smtp-Source: AGHT+IGGsNtnlZsAHvvhsHf653TGOP06UKHgdwJYLMCIzieif8gGQxw0FckUiShcHgv/KNTOFNJriO0c0FrhCrOBfn8= X-Received: by 2002:a7b:c3c8:0:b0:41f:a9ac:1023 with SMTP id 5b1f17b1804b1-41feab40b9fmr147531725e9.17.1715794324108; Wed, 15 May 2024 10:32:04 -0700 (PDT) MIME-Version: 1.0 References: <4FB3A3BB-1CFA-4BC7-9DC2-CC9138B8325C@gmail.com> <2ff4cb73-352f-44e1-844b-5bb6cc92e1fe@posixcafe.org> <04a0afc1-6440-47b3-957c-0071ad88b117@posixcafe.org> In-Reply-To: From: Lucio De Re Date: Wed, 15 May 2024 19:36:47 +0200 Message-ID: Subject: Re: [9fans] List of companies that use Plan 9. To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary=00000000000032415c0618817faf Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 10a61c2a-12e1-11ef-81cb-7592028c7b06 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UYWQzZGMwYzkzMDM5YTdkMi1NMzA2YTZlZTQxN2U4ZTkxYzBjOWUw?= =?UTF-8?B?MWE3Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M306a6ee417e8e91c0c9e01a7:1:t-UDB_7OmpMLHtLA-K5k67eAd7sfadWJylbggGtT8qs --00000000000032415c0618817faf Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Factually, Fossil is no big deal. Its design shortcomings have been raised in the past from the Bell Labs side and the documentation (for Venti, I think, but it's not very important) suggests that Fossil was knocked together as a minimal Venti cache so the benefits of Venti could be utilised and the old file system could be abandoned. I somehow missed that discussion at the time and never went back to find out how it panned out. But it sure feels with hindsight that Fossil became the trigger for the 9front schism and that would explain the sensitivity on either side. It's a shame, because the Venti potential remains unrealised as there isn't the Fossil bridge (where development is continuing, in 9front) to a better, full functionality file system that includes Venti backing storage. Which brings me to the question I have been meaning to ask: what scope does Venti serve in the absence of Fossil? I appreciate that VAC is a handy form of archiving, but does it justify the complexity of configuring and maintaining a Venti archive? I know that vacfs has some failings I haven't had the opportunity or the inclination to investigate, but exhibit themselves only in P9P - in my experience. So is Venti only a trophy application, or are there serious uses for it among the 9front community? Lucio. On Wed, May 15, 2024 at 7:04=E2=80=AFPM Jacob Moody w= rote: > On 5/15/24 11:20, Don Bailey wrote: > > > > I have zero emotional attachment to Fossil. What I am asking for, not > even demanding, is a fact-based assessment of the asserted issue. Pointing > at the code is not an emotional attachment. It's literally the opposite. > It's asking to demonstrate and document the issues, instead of asserting > that something is awful because /you/ have had an emotional reaction to it > failing. How did it fail? Can you reproduce it? What code is bad? Why is > the code bad? If you can't answer these questions, maybe you > > shouldn't have removed it. >=20 > The emotional accusation I understand, it really seems like it's just > fossil that evokes this > reaction out of people. Just fossil that makes people want us to prove > without any reason of doubt that the > code should have been removed. I also just don't understand why people are > so attached to fossil. > Is it because people feel like there is a high burden of evidence for > touching the holy code > as ordained by bell labs? We didn't want it so it went. If you think this > is actually a > mistake and there is a world of possibility to be had thanks to fossil in > Plan 9 I encourage > you to maintain fossil yourself and prove to us that we were wrong in > thinking it was dead weight. >=20 > I want to specifically compare the discussion that happened on this thread > between p9sk1 > and fossil. We think that no one should be using p9sk1, and so we spent > the time to explain > to others the very real, concrete and specific issues with the code and > implementation. >=20 > We are not telling any other user of Plan 9 to not use fossil if they'd > like, we simply don't want to > deal with it in 9front. I think the burden of proof you are putting on us > to make this > decision would only make sense if we were advocating for other > distributions and current > users of fossil to no longer use it. It's fine, we're just not interested > in it, sorry. >=20 > As I, and others, have pointed out now a couple of times. Adding fossil > back to 9front > is trivial. Perhaps you haven't had the experience of having to sit in irc > and help > new users get going with the system who really don't have opinions about > anything and > then dealing with the outcomes when things blow up. As you said fossil is > not exactly > easy to deal with, it needs a lot of special consideration. So why then > are you complaining > that 9front made the decision to remove that option for the uninformed > user? Does it not > make more sense to direct users towards a filesystem that is more > resilient and requires > less watering? >=20 > All of this is entirely moot with gefs right around the corner. I can't > imagine someone > willingly want to use fossil with gefs as a (soon to be) alternative. >=20 --=20 Lucio De Re 2 Piet Retief St Kestell (Eastern Free State) 9860 South Africa Ph.: +27 58 653 1433 Cell: +27 83 251 5824 ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/Tad3dc0c93039a7d2-M306a6= ee417e8e91c0c9e01a7 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --00000000000032415c0618817faf Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
Factually, Fossil is no big deal. Its design s= hortcomings have been raised in the past from the Bell Labs side and the do= cumentation (for Venti, I think, but it's not very important) suggests = that Fossil was knocked together as a minimal Venti cache so the benefits o= f Venti could be utilised and the old file system could be abandoned.
<= br />
I somehow missed that discussion at the time and never went= back to find out how it panned out. But it sure feels with hindsight that = Fossil became the trigger for the 9front schism and that would explain the = sensitivity on either side. It's a shame, because the Venti potential r= emains unrealised as there isn't the Fossil bridge (where developm= ent is continuing, in 9front) to a better, full functionality file system t= hat includes Venti backing storage.

Which brings= me to the question I have been meaning to ask: what scope does Venti serve= in the absence of Fossil? I appreciate that VAC is a handy form of archivi= ng, but does it justify the complexity of configuring and maintaining a Ven= ti archive? I know that vacfs has some failings I haven't had the = opportunity or the inclination to investigate, but exhibit themselves only = in P9P - in my experience. So is Venti only a trophy application, or are th= ere serious uses for it among the 9front community?

<= div>Lucio.

On Wed, May 15, 2024 at 7:04 PM Jacob Moody <moody@posixcafe.org> wrote:
On 5/15/24 11:20,= Don Bailey wrote:
>
> I have zero emotional attachment to Fossil. What I am asking for, not = even demanding, is a fact-based assessment of the asserted issue. Pointing = at the code is not an emotional attachment. It's literally the opposite= . It's asking to demonstrate and document the issues, instead of assert= ing that something is awful because /you/ have had an emotional reaction to= it failing. How did it fail? Can you reproduce it? What code is bad? Why i= s the code bad? If you can't answer these questions, maybe you
> shouldn't have removed it. 

The emotional accusation I understand, it really seems like it's just f= ossil that evokes this
reaction out of people. Just fossil that makes people want us to prove with= out any reason of doubt that the
code should have been removed. I also just don't understand why people = are so attached to fossil.
Is it because people feel like there is a high burden of evidence for touch= ing the holy code
as ordained by bell labs? We didn't want it so it went. If you think th= is is actually a
mistake and there is a world of possibility to be had thanks to fossil in P= lan 9 I encourage
you to maintain fossil yourself and prove to us that we were wrong in think= ing it was dead weight.

I want to specifically compare the discussion that happened on this thread = between p9sk1
and fossil. We think that no one should be using p9sk1, and so we spent the= time to explain
to others the very real, concrete and specific issues with the code and imp= lementation.

We are not telling any other user of Plan 9 to not use fossil if they'd= like, we simply don't want to
deal with it in 9front. I think the burden of proof you are putting on us t= o make this
decision would only make sense if we were advocating for other distribution= s and current
users of fossil to no longer use it. It's fine, we're just not inte= rested in it, sorry.

As I, and others, have pointed out now a couple of times. Adding fossil bac= k to 9front
is trivial. Perhaps you haven't had the experience of having to sit in = irc and help
new users get going with the system who really don't have opinions abou= t anything and
then dealing with the outcomes when things blow up. As you said fossil is n= ot exactly
easy to deal with, it needs a lot of special consideration. So why then are= you complaining
that 9front made the decision to remove that option for the uninformed user= ? Does it not
make more sense to direct users towards a filesystem that is more resilient= and requires
less watering?

All of this is entirely moot with gefs right around the corner. I can't= imagine someone
willingly want to use fossil with gefs as a (soon to be) alternative.
=


------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/Tad3dc0c93039a7d2-M0565bff8d967be11771601= b6
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription


--
Lucio De Re
2 Piet Retief St
= Kestell (Eastern Free State)
9860 South Africa

Ph.: +27 58 = 653 1433
Cell: +27 83 251 5824
= --00000000000032415c0618817faf--