From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.7 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: from tb-ob0.topicbox.com (tb-ob0.topicbox.com [64.147.108.117]) by inbox.vuxu.org (Postfix) with ESMTP id 0B58323512 for ; Fri, 10 May 2024 15:20:15 +0200 (CEST) Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 0D5281C00A for ; Fri, 10 May 2024 09:20:15 -0400 (EDT) (envelope-from bounce.mMd673c9d1e7254a50932e772a.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 0A5C81822514; Fri, 10 May 2024 09:20:15 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=WpOkQfdq header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f46.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1715347214; bh=4tJ7c3qNdxOXo/pt mxoXNd8rzLGHksFbtetm20a+NfE=; b=bQ5DKlIg/r0YL4+Cv00Qwn8yvg5n5tN3 w2HTxAX0/YFdk3zr+b4R9FJCLu1Y2ad5oyA9tJR2mt1F6YFs/H16heW3Snywd+0H k00duK3pexlRG8ATW+CcpmWSsTtXw/2qI95sua3sNtAs9+bGlIvJGvjNb/QcvJMI g7I7ruplGNI= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1715347214; b=Xdgvx5F8oIfOQ9Cs5oJUfMkrcLeFImdVhV6MfV0EeX+4aLjxhD rVtQYJVqHjSkixdDfl3Mi1NSvMXcPDRwGsS6aXhfZnCiPrfq5CDtZqypepX59Y/h FkMQvUyzNXZt4VkJoLVQ9QcrwnHAPYh7ATpMK+E7OGuJELbyywRz/RJo4= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=WpOkQfdq header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f46.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=WpOkQfdq header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.46 (mail-lf1-f46.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f46.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=gVQAmN82; x-me-sender=none; x-ptr=pass smtp.helo=mail-lf1-f46.google.com policy.ptr=mail-lf1-f46.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1715347214; x=1715433614; bh=YcrV8Z9dzzH0uiOHyOBfYBUNqLGup7ik LHp3+sUMeRE=; b=Zqh71yYZZU9GvAuP5aKaG3YZgCuc0z+sVGbGVHeWLSDgCjOV +chBF8ckJ35rKxdSyjMrwks90JWcU9K9fTCDC6IWDhXMR9BTKOtgwXWyHKYb42wL tGaBu2+H/Fk4KAsE1MwclZW6vYZCaaiChgg7Lum5cLQxhmc4JENgY6xuI/U= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 03A7B182202B for <9fans@9fans.net>; Fri, 10 May 2024 09:19:52 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 0811620F84E; Fri, 10 May 2024 09:19:52 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1715347192; b=DFRJlyq+MYHadV9N8r5Dddha2I3e9r/PcBezAMIFH/NSfjuXFZ voP/57LcZYq9sAfo8iv5MC1JaGTgrKT4wsUOvDp2pfu5gPxADYVqyxY2Ni84UDKH EOnZRn6iYuMEV5pogQO8onrtdxYpq74Dnec3Z/EB0sGyAx50bqPaIq+OHzoMV+7x QhG4k1E7eZswz5lEuoLJ+jpDvN1dOSXX3k1nQxPB+OC0mgAQxPfx7fLw5CuJ5JLM dhjRpuGkmUxCobkVIzF1Z3tcEevOry1QDSq3UI3oRm6huwBUXoBh60bV2ysUZ8Sq 8Dd17akwxe56E9bK0cqkYr5t6BO09+fZvTGw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1715347192; bh=yFoQawjBmlWsoDWvZHS2MZaP0/F7Eo4gNYBG7UURjBA=; b=Lrau0xvePqjr BFYzFokUiYirmWKoWhxlvxgeOHhNwTDoW5Dcp1PAlhDTzAMFKVNk4pBdaHTySYPb khCc/ViUzEBfV2y+I5Zr0WpqmNgYkc+uCn9GULwM9Mmn9qyORi0BEQrGV/+XMC10 nSg5j96FGphr2IsslS/JU1EIPVoDGqtjH7YiWgEWt3ZtyZ3yLolTI+W4QGIgNMwo wx/xXvhYvug/nUEFSLj3f2zp3b7grSLBw5ZxhuXFz9Be2zL40NHFmJ5Z9gTecJWv HJvAHpjICcyaMwtUX2cI3mJPehko0lOfLd/nZT434bk6oV8J5ZbiIYk8P6zWLXWO yTGbLRFaiQ== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=WpOkQfdq header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.46 (mail-lf1-f46.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f46.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=gVQAmN82; x-me-sender=none; x-ptr=pass smtp.helo=mail-lf1-f46.google.com policy.ptr=mail-lf1-f46.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvledrvdefkedgieefucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf ffkffuvfgtsegrtderredttdejnecuhfhrohhmpefnuhgtihhoucffvgcutfgvuceolhhu tghiohdruggvrhgvsehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpefhhedthe ffgedvfeduvdduhedvhfetfeehjeduvdehhfeghedugffgiedthfehffenucffohhmrghi nhepthhophhitggsohigrdgtohhmnecukfhppedvtdelrdekhedrudeijedrgeeinecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrdduieej rdegiedphhgvlhhopehmrghilhdqlhhfuddqfhegiedrghhoohhglhgvrdgtohhmpdhmrg hilhhfrhhomhepoehluhgtihhordguvghrvgesghhmrghilhdrtghomheqpdhnsggprhgt phhtthhopedupdhrtghpthhtohepoeelfhgrnhhsseelfhgrnhhsrdhnvghtqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'lucio.dere@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="lucio.dere@gmail.com"; helo=mail-lf1-f46.google.com; client-ip=209.85.167.46 Received: from mail-lf1-f46.google.com (mail-lf1-f46.google.com [209.85.167.46]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 10 May 2024 09:19:52 -0400 (EDT) (envelope-from lucio.dere@gmail.com) Received: by mail-lf1-f46.google.com with SMTP id 2adb3069b0e04-51f3a49ff7dso2581176e87.2 for <9fans@9fans.net>; Fri, 10 May 2024 06:19:52 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1715347190; x=1715951990; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=yFoQawjBmlWsoDWvZHS2MZaP0/F7Eo4gNYBG7UURjBA=; b=gVQAmN82TQkqbzjEXvL0mJTRI1DnnNGfPTpgLy8Aoch5P8hcmhlzRapYmA3UASWBXQ Xg16NrbyRhqyO46ixhLJSujwgiOAyQ7bt252QwJc2MEyFptS2PVKTPUZ0iiE2AL2MSi9 YnQtVdAv7Qyl65cEEbXoEyiiduobfRmkhGoVEqn1bQuwu+9Z7rmYRSKuf4wFIyRG0Z6i lXlO2PCFMd8uQeAHFKv02hMhhhKnIXQgM7XUzxyW01S3TfPKStJR+izshlZgfu+DLgsf uObmOe2boSxpYLJ7GkwJAKWqHDkPDiOC5IJOXv5NfaXNs+QM8DWEkhYtjmqOnJWAE9CH oGHA== X-Gm-Message-State: AOJu0YzulebC1QN7kC9DXeLhojMmRkFTwEsLqxcqtE4gWtj63D39UyiD oWL1uLpVZXA1v6XobqN1sxwHddkTel5VB+1E27RAD2IG30RQE8Z0awzNSPIrNvdvtvjXdQ68Wwp g6e6WKOPC9iI6U2JbDsiyAyCdXgNSRg== X-Google-Smtp-Source: AGHT+IHC2/NAe0wuizMEDSaoTOR9EPiSKIA7nATaTbPAw7/5otv7HKQN9Y4JWyMdmfuy/Y1/BM8cZ7y/SlvWY35IFq4= X-Received: by 2002:a05:6512:3f0:b0:51d:5e78:17fa with SMTP id 2adb3069b0e04-5220fc7370dmr1577164e87.4.1715347190334; Fri, 10 May 2024 06:19:50 -0700 (PDT) MIME-Version: 1.0 References: <31BB1E7FB4EDB3600A876C5F1506E804@migadu.com> In-Reply-To: From: Lucio De Re Date: Fri, 10 May 2024 15:19:37 +0200 Message-ID: Subject: Re: [9fans] Balancing Progress and Accessibility in the Plan 9 Community. (Was: [9fans] Interoperating between 9legacy and 9front) To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary=000000000000f24ff9061819639e Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: ffb84c0e-0ecf-11ef-bb60-d7ac098c7b06 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UY2YxMjhmYTk1NWI4YWFmYy1NZDY3M2M5ZDFlNzI1NGE1MDkzMmU3?= =?UTF-8?B?NzJhPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:Md673c9d1e7254a50932e772a:1:RvxKyF0mm0LiXIbRbyTHhoa1Nkbwu8SlCkz-wi2YKWQ --000000000000f24ff9061819639e Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Most certainly not. I called him Jacob in my first response, but that was followed by someone using the surname and I thought I had originally got the surname wrong, probably by reading it wrong in the incoming message. I did consider being wrong, but I thought someone would correct me. Now you did. My apologies to Jacob, first, and second to anyone else who may have found my behaviour offensive, Lucio. On Fri, May 10, 2024 at 2:39=E2=80=AFPM thedaemon via 9fans <9fans@9fans.ne= t> wrote: > His name is Moody, you keep spelling it differently in what I can only > assume is a passive aggressive way to insult him? > > =E2=80=94 thed=C3=A6mon > > On Friday, May 10th, 2024 at 6:53 AM, Lucio De Re > wrote: > > I am not allowed to ignore some advice when Vic raises a much more > interesting subject matter and does it in a perfectly justified and well > formulated fashion - and gets accused of being an AI or at minimum playing > one on 9fans? > > How do you know that I did not follow any of Moodley's advice, which > incidentally I acknowledged I may not be competent to follow? None of the > legacy people I have noted responding have been even remotely as offensive > as those who are determined to deify 9front in legacy's place - when there > is no effort on legacy's side to promote our particular preference, nor to > justify such preference as being superior in any manner. > > What I notice - correct me if I am mistaken - is that any comparison > between 9front and 9legacy seems to needle a few members (very few, there > are many names from that community that have not participated, specifical= ly > the ones I know hand have long respectes, ask them) of the 9front communi= ty > that seem to take offence unless 9front is painted in a better light. I > guess that's permissible, but please mind your manners if you choose to go > that route, this is 9fans and 9front I believe has its own discussion > groups. > > Lucio. > > On Fri, May 10, 2024 at 12:22=E2=80=AFPM qwx via 9fans <9fans@9fans.net> = wrote: > >> On Fri May 10 11:09:32 +0200 2024, lucio.dere@gmail.com wrote: >> >> > I'm finding it ironic, though, that the defenders of the true 9front >> faith >> > find it necessary to insult their "enemies" in a forum dedicated to the >> > very subject matter they are so disapproving of. Surely they realise >> that >> > 9fans is a stupid place to do so? >> > >> > Lucio. >>=20 >> Several people, including 9front users, have tried to help you and >> provided you with ways to accomplish your task; they have been so far >> ignored. Even Moody himself gave you alternatives and arguably easier >> ways to do it. Here's another one: mycroftiv's ANTS was in sync with >> 9front for a while and fully supports fossil; it is now out of date >> but the last ANTS release will probably work on your hardware. iirc >> noam had also tried to update it based on latest 9front some time >> ago, but I'm not sure where that lives. >>=20 >> You have everything you need, courtesy of your "enemies", the >> "defenders of the true 9front faith", whatever that is supposed to >> mean. What have you tried so far, did it work? >>=20 >> Thanks, >> qwx > > > -- > Lucio De Re > 2 Piet Retief St > Kestell (Eastern Free State) > 9860 South Africa > > Ph.: +27 58 653 1433 > Cell: +27 83 251 5824 > > > *9fans * / 9fans / see discussions > + participants > + delivery options > Permalink > > --=20 Lucio De Re 2 Piet Retief St Kestell (Eastern Free State) 9860 South Africa Ph.: +27 58 653 1433 Cell: +27 83 251 5824 ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/Tcf128fa955b8aafc-Md673c= 9d1e7254a50932e772a Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --000000000000f24ff9061819639e Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
Most certainly not. I called him Jacob in my f= irst response, but that was followed by someone using the surname and I tho= ught I had originally got the surname wrong, probably by reading it wrong i= n the incoming message. I did consider being wrong, but I thought someone w= ould correct me. Now you did.

My apologies to Jacob, first, and = second to anyone else who may have found my behaviour offensive,

=
Lucio.

On Fri, May 10, 2024 at 2:39 PM thedaemon v= ia 9fans <9fans@9fans.net> wro= te:
His name is Moody, you= keep spelling it differently in what I can only assume is a passive aggres= sive way to insult him?

— thedæmon
<= /div>
<= br />
On Friday, May 10th, 2024 at 6:53 AM, Lucio De Re <lucio.dere@gmail.com> w= rote:
I am not allowed to i= gnore some advice when Vic raises a much more interesting subject matter an= d does it in a perfectly justified and well formulated fashion - and gets a= ccused of being an AI or at minimum playing one on 9fans?

How do= you know that I did not follow any of Moodley's advice, which incident= ally I acknowledged I may not be competent to follow? None of the legacy pe= ople I have noted responding have been even remotely as offensive as those = who are determined to deify 9front in legacy's place - when there is no= effort on legacy's side to promote our particular preference, nor to j= ustify such preference as being superior in any manner.

What I notice - correct me if I am mistaken - is that any comparison betw= een 9front and 9legacy seems to needle a few members (very few, there are m= any names from that community that have not participated, specifically the = ones I know hand have long respectes, ask them) of the 9front community tha= t seem to take offence unless 9front is painted in a better light. I guess = that's permissible, but please mind your manners if you choose to go th= at route, this is 9fans and 9front I believe has its own discussion groups.=

Lucio.

On Fri, May 10, 2024 at 12:22= 02F;PM qwx via 9fans <9fans@9fans.net> wrote:
On Fri May 10 11:0= 9:32 +0200 2024, lucio.dere@gmail.com wrote:
<= br /> > I'm finding it ironic, though, that the defenders of the true 9fro= nt faith
> find it necessary to insult their "enemies" in a forum dedic= ated to the
> very subject matter they are so disapproving of. Surely they realise t= hat
> 9fans is a stupid place to do so?
>
> Lucio.

Several people, including 9front users, have tried to help you and
provided you with ways to accomplish your task; they have been so far
ignored.  Even Moody himself gave you alternatives and arguably easier=
ways to do it.  Here's another one: mycroftiv's ANTS was in sy= nc with
9front for a while and fully supports fossil; it is now out of date
but the last ANTS release will probably work on your hardware.  iirc noam had also tried to update it based on latest 9front some time
ago, but I'm not sure where that lives.

You have everything you need, courtesy of your "enemies", the
"defenders of the true 9front faith", whatever that is supposed t= o
mean.  What have you tried so far, did it work?

Thanks,
qwx

------------------------------------------
9fans: 9fans
Permalink: https://9fans.topicbox.com/groups/9fans/Tcf128fa955b8aafc-M1c1e= 596f85b044c93a1ab637
Delivery options: https://9fan= s.topicbox.com/groups/9fans/subscription


--
Lucio De Re
2 Pi= et Retief St
Kestell (Eastern Free State)
9860 South Africa
=
Ph.: +27 58 653 1433
Cell: +27 83 251 5824



--
Lucio De Re
2 Piet Retief St
Kestell (Eastern = Free State)
9860 South Africa

Ph.: +27 58 653 1433
Cel= l: +27 83 251 5824
= --000000000000f24ff9061819639e--