From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 37591A44FF4 for <9fans@9fans.net>; Sun, 24 Nov 2019 23:01:40 -0500 (EST) (envelope-from lucio.dere@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 251D17B899B; Sun, 24 Nov 2019 23:01:40 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1574654500; b=KOyJ2v00rKQts1qbAfxd2InMlWEpONervdcBC+6wqDE2vR4fmr vWKY/V/cQMIdBPwM+PW2D5qDtPoJZtU3RuR0M+dCbU2S31PU7Dp6wKfuaZBa9a+c e3Us2tigDGTj6+l6ltzcp0Uq4mfkUR5y0srsusZo0hwQxftVwGilL9ieUZ+dYGuc Izu6uAxc6sTlmC/KX0Pv1lNshoHzLamzE9cLbnDtfK/IjEoA4xBN8HSuHovwDxA3 n3/VpciVfxfliKFaQYpIKmH77hQ/I3YzTAEjih/+EfLDCiwl4bHGMECDFVBpZD8J 2TG45abHYFnf2nK0EUVhcBHzZRHAsU9Ll2iQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:in-reply-to:references:from:date :message-id:subject:to:cc:content-type; s=arcseal; t=1574654500; bh=ncmIPMpeyqt5/VCRcYQynz0Z9IptQsCPYXXbUG+i00M=; b=KT3zuoeVOzhb T1O/lF9p1XLXTy6UiaKGboqzcLsELYh64ZAbRIXlE+iFB2efnk6+uIN7YNgsCIGn btT1gWWbjLzj0KcgNXp9EplaBn+QUYfk0xUnxN+26xoHwrWVM2FrLWDGCno0jH7p xFtXNKY4I34GCExgUWmpXOU7eUj0+Ng7oHulWTz59Z74/XXWzPhEHf/5E2ok+vN1 1OTYC+1of81gM5aCkS9pih/PckVa3gwvHLqqXZVNknwRB2p30v3UaSFlANqJ/RjJ AU1klK6rrpCVj2SgjJGKuIOQVsm55rcDhSLqblyfJi+1uVBwUu4mLifA1i3La1JP wY2bJB5fRw== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=j+nkoan8 header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.50 (mail-lf1-f50.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f50.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=qpHySBn9; x-ptr=pass smtp.helo=mail-lf1-f50.google.com policy.ptr=mail-lf1-f50.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Record found); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Record found); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=j+nkoan8 header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.50 (mail-lf1-f50.google.com); spf=pass smtp.mailfrom=lucio.dere@gmail.com smtp.helo=mail-lf1-f50.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=qpHySBn9; x-ptr=pass smtp.helo=mail-lf1-f50.google.com policy.ptr=mail-lf1-f50.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Record found); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Record found); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedufedrudeitddgtdehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpegjfhfhff fkuffvtgesthdtredttddtjeenucfhrhhomhepnfhutghiohcuffgvucftvgcuoehluhgt ihhordguvghrvgesghhmrghilhdrtghomheqnecukfhppedvtdelrdekhedrudeijedrhe dtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrudeijedrhedtpdhhvghlohepmhgr ihhlqdhlfhduqdhfhedtrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpeeolhhutg hiohdruggvrhgvsehgmhgrihhlrdgtohhmqecuuffkkgfgpeejheelleenucevlhhushht vghrufhiiigvpedt X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'lucio.dere@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="lucio.dere@gmail.com"; helo=mail-lf1-f50.google.com; client-ip=209.85.167.50 Received: from mail-lf1-f50.google.com (mail-lf1-f50.google.com [209.85.167.50]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sun, 24 Nov 2019 23:01:39 -0500 (EST) (envelope-from lucio.dere@gmail.com) Received: by mail-lf1-f50.google.com with SMTP id f16so9846716lfm.3 for <9fans@9fans.net>; Sun, 24 Nov 2019 20:01:39 -0800 (PST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:in-reply-to:references:from:date:message-id:subject:to :cc; bh=ncmIPMpeyqt5/VCRcYQynz0Z9IptQsCPYXXbUG+i00M=; b=j+nkoan82sB26bLU2E8MWelwSxqkCQr1hbz643pJUAektStx+/X+fJKLEVEcExA+rf QcJc5X02KLWUugAOS5e0wSJTv1Kr+s/CN+VPOHoi2UY2p7qSeZ/9PKOVBmCsH35TRvJS nU7XhkmjsKqdrhHCBjh6An+q0mLGUS8rcJTivnR7FjRQJOcxGpq2hP6jR3fzrqA5vW7l 3fAbV52ajIWoqQ5E8CrCmLR/7+W426hOfRCshCFbd9/888pSEz3QJUPw7lvZsLnx6RrO a15XbE2YtMxUuQtkKEGVvgMD1MWw6m2ovCUJGd+RgYTv2PXPmMUSl9nSMdShwgQhZeLW ib6A== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:in-reply-to:references:from:date :message-id:subject:to:cc; bh=ncmIPMpeyqt5/VCRcYQynz0Z9IptQsCPYXXbUG+i00M=; b=qpHySBn9WC05mKa0PAr9ChP94eIKTN/v1Yxp9wqN3X/5vI1KUojovM3g6Lm8ylvmCj dZ+WYMi4y2NxRqdEk7cLeBvSBchzVKYduOJm8isRUV+aj35go02Cu6bCqhlT4nJs6PGg GOP0L46C+zF/mdrLeCt0wXvKdOO1+r8ER1fUxoVjfMx+Gr+sbbcEgDmn15QQ3jEUrX8v 2qmPWxeT9PMKilLNxm9FFSBOf+CQNbJdfTBtt56JjAdRreJvxJE8z6E2EbFWVRE9d2Zj GVPXfhhnVM00EMQk43yYF1wEezDrFi0wQHEDcDyvYI+kQAqCzac/ApRl26FRK4Zumr1h MdbQ== X-Gm-Message-State: APjAAAXGC9GbarkM3y4XjKGJ+PoGpiS8cvbTjW8l84Zo67nhrqWIkGSN NzLZWyG2TUlEGFQuSQmYv1PcSmSbx6lkM7jqDRgGvg== X-Google-Smtp-Source: APXvYqxw63Ov6+QQib4JmOWs7zpVXq6dy7BVeLa6QzafwAo1crpXho3NeKxVsUe0XnxWHD+9F6S+cjvvGfUZS/1h5ys= X-Received: by 2002:a19:4bd4:: with SMTP id y203mr16354603lfa.61.1574654498212; Sun, 24 Nov 2019 20:01:38 -0800 (PST) MIME-Version: 1.0 Received: by 2002:a2e:7619:0:0:0:0:0 with HTTP; Sun, 24 Nov 2019 20:01:37 -0800 (PST) In-Reply-To: References: <83054678AC38490907D956243528B1D4@ewsd.inri.net> <2566f3964ef2455c38c1576b7f68fc45@hamnavoe.com> <20191123201701.GA14389@wopr> <20191123202735.GB14389@wopr> <20191124020302.GA70376@wopr> <20191124123235.a29ba3f7a14a69365c377ecf@eigenstate.org> From: Lucio De Re Date: Mon, 25 Nov 2019 06:01:37 +0200 Message-ID: Subject: Re: [9fans] Is the vanilla Plan 9 still alive? To: Ori Bernstein Cc: 9fans <9fans@9fans.net> Content-Type: text/plain; charset="UTF-8" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 4b51f7ec-0f38-11ea-a11b-8ba92eec93c7 BTW, I miss SSH a lot more often than I miss a browser when using legacy Plan 9. It keeps being what I would port from 9front immediately if I simply had the skills, the time and the persistence. There are one or two more things that may only pop up once caffeine has had its impact on my rather slow brain. I am very extremely grateful for 9legacy, even though I don't really understand what is and what is not possible using it, so I stick to my own modified version of Plan 9 which occasionally leaps from one antiquated host to anotherless antiquated one and were I at total leisure, my dream would be of threading into that, in a repeatable experiment, all the useful imported beads (from 9legacy, 9front and 9atom, more or less in that priority sequence) that I would deem appropriate for 2019 and the future. But there are many directions to take and only one that this mailing list's membership would find it convenient to support. Such a standard (that I had recently named 9heritage in my personal notes) will need a lot of contributing by people who are willing to collaborate where they are instead tempted to compete, to follow when they instead wish to lead. Keep in mind that I live in a country that has unofficially declared my kind "colonials of a special kind" to pamper to a majority that is split in nine cultural groups (plus a few less despised minorities) whose resentment towards whites is their only binding force. I have personal experience of where competing interests lead and of how hard it is to promote common interests in their place. Plan 9 right now is in a similar place, mostly through a similar lack of respected leadership, if my political opinion is to be trusted. Lucio. PS: Is Ori's Git and a plethora of "git forks" (I see that Git itselfs calls them "heads", how appropriate!) the way to go? I can see some merit in stripping Labs' system down to the bone and fleshing it up from the bottom (or is that the top) with the best the community has already contributed. In 24 years, this has not happened, what is most likely to do it today? PPS: I think it was Hiro that contrary to expectations sang the praise of Richard's Raspberry PI developments and opened one more interesting door for me. It is precisely these pearls (both Hiro's and Richard's) that keep me a perhaps undeserving 9fan. On 11/25/19, Lucio De Re wrote: > On 11/24/19, Ori Bernstein wrote: >> On Sun, 24 Nov 2019 08:34:32 +0200, Lucio De Re >> wrote: >> >>> We just got a mouthful from sl and you about the lack of explanation >>> for the state of the various plan 9 "distributions". It all smacks of >>> expecting Da Vinci to update the Mona Lisa because somebody would >>> prefer a high-rise landscape in the background and because someone >>> actually did photoshop the Mona Lisa in that guise, but was not >>> accepted as the most significant contributor to the painting. >> >> I'm not sure that analogy serves the purpose intended. >> >> The Mona Lisa is something sitting in a museum for >> people to gawk at a bit before getting on with their >> day to day business, using tools that they either >> adapt to their needs, or replace with ones that are >> already suitable. >> > Having grown up in the country that spawned many Mona Lisa thieves, I > simply disagree with your evaluation, Ori. That is no reflection of > the worth of your contribution(s), just a cultural chasm between the > two us. > > And having spent a week visiting Florence (sorry, can't resist > first-hand anecdotes), I can see both your more pragmatic point of > view and my own interest in archaeology. I would like to persuade you > otherwise, but maybe that will happen to you without my help. > > Until then (a) I'll be happy but cautious to help you bring the ONE > Plan 9 to term and will provide all resources at my disposal to do > that and (b) will continue to ensure that the reasons and rationales > for Plan 9 are not lost in the quest for Shiny New Features. > > 9p.io is a museum piece, I grant, let it stay. If the Mona Lisa or the > Lamborghini Miura or some similar monuments to human creativity do not > appeal to you, let me appeal to you on behalf of those who feel like > me, so that you do not contribute to their destruction. > > In my opinion and my philosophy, without history there is no future. I > can see how that may seem pointless to some, at least for a time. > > Lucio. > -- Lucio De Re 2 Piet Retief St Kestell (Eastern Free State) 9860 South Africa Ph.: +27 71 471 3694 Cell: +27 83 251 5824