From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 691CC3A6D6D for <9fans@9fans.net>; Fri, 25 Oct 2019 00:21:17 -0400 (EDT) (envelope-from skip.tavakkolian@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 61809659AB3; Fri, 25 Oct 2019 00:21:17 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1571977277; b=efUuHjyJsHAa8wfgJ2JJLzUxqCOoowRfKzOUXVHH5GIKl31btX Ra327bBouDutCV/Gpc676G0BBiMH3ZVx1jJ5yBmuTBtH4WYDLBGo03sDlj0B9pa9 S2dMJr5/ECj1t3Q57RHrg0DSIsMP209bxKY3bTrUPQJ/XFmK498G6KdQTqOoQyxq rcPxEJK/9QJ6Z7/9QisoOgtcquaHLCVJXWqIva70PWEDS3haEcIKqb8HHqJnyWmq 0phIQ1Ytf6cne7+mtCG/JwVqBZ1+XpinHCS3lO6QcG/TJBeUDgogr2DiMOjj7ye7 eiznWpKxay/H9KueXp5qtcCVlNu+1sbwugTA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1571977277; bh=t1NROzVXYUAqzg4cQmOzgrvM4DDIs8fOreR6Zlk3FW4=; b=P3S9PrNk0Odr aG2KT+F1b/+BbUiDDCVN5HQK8GrotahdqRaLoOPWhuEmeIyeKoQnZiT0TC+2u9tW Gv76RCEAldX6ee7Ji6i0OMC7+3XbfnljXNLBNP7OXpR4vCOlHBua7z13NOMrkU+9 h8t4VTDRfoPhA6GYVq+5HvIDIMyU1zfSmYY9gXPKZWVjaOg47QCaWZ3pui6Bo+qj n7Cvox0S80VEKl7G6nR4kAUOZEeM01Cb0c2PVfOaani+AXNBu4YjjOJwHy9dOflE y/VJ/rsvEKMz/aGGYkttrG4xLED4aRPo/HNMkS1NojCAecou8lEVA41GYZP5dbMA T1xKQYdWbQ== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Wo8Wbo3Y header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.53 (mail-vs1-f53.google.com); spf=pass smtp.mailfrom=skip.tavakkolian@gmail.com smtp.helo=mail-vs1-f53.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=I08BR2h2; x-ptr=pass smtp.helo=mail-vs1-f53.google.com policy.ptr=mail-vs1-f53.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Record found); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Record found); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-100 state=0 Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=Wo8Wbo3Y header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.53 (mail-vs1-f53.google.com); spf=pass smtp.mailfrom=skip.tavakkolian@gmail.com smtp.helo=mail-vs1-f53.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=I08BR2h2; x-ptr=pass smtp.helo=mail-vs1-f53.google.com policy.ptr=mail-vs1-f53.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Record found); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Record found); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-100 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedufedrledvgdekudcutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpggftfghnshhusghstghrihgsvgdpuffr tefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnth hsucdlqddutddtmdenucfjughrpeggfhgjhfffkffuvfgtsegrtderredttdejnecuhfhr ohhmpefukhhiphcuvfgrvhgrkhhkohhlihgrnhcuoehskhhiphdrthgrvhgrkhhkohhlih grnhesghhmrghilhdrtghomheqnecuffhomhgrihhnpehtohhpihgtsghogidrtghomhen ucfkphepvddtledrkeehrddvudejrdehfeenucfrrghrrghmpehinhgvthepvddtledrke ehrddvudejrdehfedphhgvlhhopehmrghilhdqvhhsuddqfhehfedrghhoohhglhgvrdgt ohhmpdhmrghilhhfrhhomhepoehskhhiphdrthgrvhgrkhhkohhlihgrnhesghhmrghilh drtghomhequcfukfgkgfepudegtdejieenucevlhhushhtvghrufhiiigvpedt X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'skip.tavakkolian@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="skip.tavakkolian@gmail.com"; helo=mail-vs1-f53.google.com; client-ip=209.85.217.53 Received: from mail-vs1-f53.google.com (mail-vs1-f53.google.com [209.85.217.53]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 25 Oct 2019 00:21:17 -0400 (EDT) (envelope-from skip.tavakkolian@gmail.com) Received: by mail-vs1-f53.google.com with SMTP id b123so577927vsb.5 for <9fans@9fans.net>; Thu, 24 Oct 2019 21:21:17 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=t1NROzVXYUAqzg4cQmOzgrvM4DDIs8fOreR6Zlk3FW4=; b=Wo8Wbo3Yxoo5Sk2E2Yf5hckooT+ryvNZUaJbKyjI3JRqUYmXnzy4xTIr4nq2vgH3wx LebiLMOgA6orPIkxU9/x55bYDlFHz8OI/Y6SXyP++sNDla4dsIADcJmnPiUNx0X7Z0Hk c+4HQhw/iRli6J100oEfe+3vJf3cSVN0Z3gYBsYvmln2c61ovcjXAhII8iaj4hgY5Np7 k4WcP/R93NRxt1X5dMEDKDwL04Vm4c5cRWXGsQieINff2gXJl4vSONFHnbWXstkWoE8q IOzwJhz0MkkNmycz1W+wWKpCKpyzdii9YIR1bufb2zJUzKioUDWsXwqKx81LUuUBK6ch Mxmw== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=t1NROzVXYUAqzg4cQmOzgrvM4DDIs8fOreR6Zlk3FW4=; b=I08BR2h2XfQeVLlc0jXBFi/paTzhhKg1cYTuUipRAOc31WhVza35Gf524/W+atilpa YmNB3rlrhS9NOVeVb/19Mw3EJKs85RIDjWpBgBDRbBUqsftjAFt+VNUEsIoUQtgFe6UN rDLCXUjOxb5XU+Ns73XXrBnCiUFdIgkcZ/jP4hu8FNp2xGJYmQi4+CLiOv4+IWs3jZiU d+zTLSnWspfJYOayUq7gvS2Dwhylp4QMKtrZKtG3i6FGU4HnimcfrwQ0Gmym/EK9JVuf jgb2pjm1yfGoz6L2T4SDAIF8NRANlPRW4U16SkDkG7moAXEw4MJW3PCQfXTNwCa4aNuU TVrA== X-Gm-Message-State: APjAAAUVFEQz2Um5DBDls6IGDXn7AzRB8wZ3OsgxFwoRzcdR9TODBpXN Bdg87TMCCyqz8sWRoYLlgeCfOx7qWIPV0Sp+5bimX8rU X-Google-Smtp-Source: APXvYqzzZe1sffAn77oPu1J7BRQzSh2+7zcOHeMUpA19YeqTC4Q6n6TcGKI68d0GvnPBnDgyaIGtBs3UpYrCPMANkfY= X-Received: by 2002:a05:6102:50b:: with SMTP id l11mr875729vsa.226.1571977275869; Thu, 24 Oct 2019 21:21:15 -0700 (PDT) MIME-Version: 1.0 References: <12912833A4EE428D8C7BBD59371AE427@mail2world.com> <8232168b-ba87-4adc-8919-684882004cd6@email.android.com> In-Reply-To: <8232168b-ba87-4adc-8919-684882004cd6@email.android.com> From: Skip Tavakkolian Date: Thu, 24 Oct 2019 21:21:04 -0700 Message-ID: Subject: Re: [9fans] Request for (constructive?) comments: Plan 9 : 2020 To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Content-Type: multipart/alternative; boundary="0000000000001f90af0595b47b2c" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: e689d738-f6de-11e9-ac99-e965a62ffa6d --0000000000001f90af0595b47b2c Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Hi Erik! Vashon might be ok depending on time of year due to limited lodging options. I plan to check the O Space for the workshop. lodging will be challenging unless we take over campgrounds and set up yurts :) On Thu, Oct 24, 2019, 1:48 PM erik quanstrom wrote: > vashon has a high density of fans. :-). (hi, skip). seriously, an iwp9 > anywhere would be great. bonus points for good weather. > > - erik > > On Oct 24, 2019 02:45, Jonas Amoson wrote: > > A new IWP9 would be great, and I=E2=80=99d be happy to help out in the pr= eparation > if needed and wanted, e.g. reading submissions, helping with troff > formatting of papers or such (although no expert really). > Regarding location, I=E2=80=99d try to attend anywhere suggested. The mor= e > important here is that some people are taking the initiative. Although > anywhere Europe would be much closer to where I am, I think that the plac= e > might be more of an issue if it would happen more frequently than every > five year :-) > > Jonas > > <-----Ursprungligt Meddelande-----> > *From: Iruat=EF=BF=BD Souza [iru.muzgo@gmail.com ]* > Sent: 23/10/2019 10:36:41 AM > To: 9fans@9fans.net > Subject: Re: [9fans] Request for (constructive?) comments: Plan 9 : 2020 > > ?I suggest we do it somewhere in Europe. I have the impression most > active users are here. > > On Wed, Oct 23, 2019 at 8:58 AM Steve Simon wrote: > > > > hi, > > > > i love the idea, what concerns me is the cost of a flight from the UK t= o > Michigan. > > > > we shall see what tickets i can find. > > > > -Steve > > > > > > > On 23 Oct 2019, at 6:49 am, ori@eigenstate.org wrote: > > > > > > ? > > >> > > >> Jeff (jas) and I have been chatting about organizing a "Plan 9 : > 2020" > > >> workshop. We're trying to gauge everyone's interest, and to solicit > agenda > > >> items, venue suggestions, and hopefully volunteers to help organize > it. > > > > > > I'd be interested in attending, and I don't mind taking some time to > > > help organize. > > > > > >> If you have a different suggestion, or are willing to offer a venue, > please > > >> comment. > > > > > > Some of us have also been talking about planning an OpenBSD-style > > > hackathon. (OpenBSD hackathons: Get developers in a room, and write > > > code for a week, exchanging ideas, trying to get commits into base an= d > > > ports. Beer is usually involved.) > > > > > > We'd discussed putting together something like that for Plan 9 in the > > > first half of 2020. Anyone hacking on Plan 9 related code would be > > > welcome. > > > > > > I don't know if this is a different suggestion so much as a different > > > event. Experience implies that merging the two together may be a bit > > > too much in one shot. > > > > > > Expect a post about that when we start sorting out the details. > > > > > ------------------------------------------ > 9fans: 9fans > Permalink: > https://9fans.topicbox.com/groups/9fans/T63bc6dc40f27ab23-M8b84343762c7f6= f77e36d786 > Delivery options: https://9fans.topicbox.com/groups/9fans/subscription > *9fans * / 9fans / see discussions > + participants > + delivery options > Permalink > > > > *9fans * / 9fans / see discussions > + participants > + delivery options > Permalink > > --0000000000001f90af0595b47b2c Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Hi Erik! Vashon might be ok depending on time of yea= r due to limited lodging options. I plan to check the O Space for the works= hop. lodging will be challenging unless we take over campgrounds and set up= yurts :)

On Thu, Oct 24, 2019, 1:48 PM erik quanstrom <quanstro@quanstr= o.net> wrote:
vashon has a high density of fans.=C2=A0 :-). (hi, skip). seriously, an= iwp9 anywhere would be great.=C2=A0 bonus points for good weather.

- erik

On Oct 24, 2019 02:45, Jonas Amoson = <jonas.amoson@home.se> wrote:
A new IWP9 would be great, and I=E2=80=99d be happy to= help out in the preparation if needed and wanted, e.g. reading submissions= , helping with troff formatting of papers or such (although no expert reall= y).
Regarding location, I=E2=80=99d try to attend anywhere sugges= ted. The more important here is that some people are taking the initiative.= Although anywhere Europe would be much closer to where I am, I think that = the place might be more of an issue if it would happen more frequently than= every five year :-)

Jonas

<-----Ursprungligt Meddelande----->
= =C2=A0
=C2=A0From: Iruat=EF=BF=BD Souza [iru.muzgo@gmail.com]<= br> Sent: 23/10/2019 10:36:41 AM
To: 9fans@9fans.net
Subject: Re: [9fans] Request for (constructive?) comments: Plan 9 : 2020=C2= =A0

?I suggest we do it somewhere in Europe. I have the impression most
active users are here.

On Wed, Oct 23, 2019 at 8:58 AM Steve Simon <steve@quintile.n= et> wrote:
>
> hi,
>
> i love the idea, what concerns me is the cost of a flight from the UK = to Michigan.
>
> we shall see what tickets i can find.
>
> -Steve
>
>
> > On 23 Oct 2019, at 6:49 am, ori@eigenstate.org wro= te:
> >
> > ?
> >>
> >> Jeff (jas) and I have been chatting about organizing a "= Plan 9 : 2020"
> >> workshop. We're trying to gauge everyone's interest,= and to solicit agenda
> >> items, venue suggestions, and hopefully volunteers to help or= ganize it.
> >
> > I'd be interested in attending, and I don't mind taking s= ome time to
> > help organize.
> >
> >> If you have a different suggestion, or are willing to offer a= venue, please
> >> comment.
> >
> > Some of us have also been talking about planning an OpenBSD-style
> > hackathon. (OpenBSD hackathons: Get developers in a room, and wr= ite
> > code for a week, exchanging ideas, trying to get commits into bas= e and
> > ports. Beer is usually involved.)
> >
> > We'd discussed putting together something like that for Plan = 9 in the
> > first half of 2020. Anyone hacking on Plan 9 related code would b= e
> > welcome.
> >
> > I don't know if this is a different suggestion so much as a d= ifferent
> > event. Experience implies that merging the two together may be a= bit
> > too much in one shot.
> >
> > Expect a post about that when we start sorting out the details.
> >

------------------------------------------
9fans: 9fans
Permalink: https://9fans.topicbox.com/groups/9fans/T63bc6dc40f27ab23-M8b84343762c= 7f6f77e36d786
Delivery options: https://9fans.topic= box.com/groups/9fans/subscription

9fa= ns / 9fans / see discussions + participants + delivery options Permalink
--0000000000001f90af0595b47b2c--