From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.9 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H4,RCVD_IN_MSPIKE_WL,URIBL_SBL_A autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 9392 invoked from network); 16 Jan 2021 07:19:40 -0000 Received: from tb-ob0.topicbox.com (64.147.108.117) by inbox.vuxu.org with ESMTPUTF8; 16 Jan 2021 07:19:40 -0000 Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 3872E19608 for ; Sat, 16 Jan 2021 02:19:38 -0500 (EST) (envelope-from bounce.mM635cb4e04d6c4b764cab5ea2.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 336021290DE6; Sat, 16 Jan 2021 02:19:38 -0500 (EST) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=qgCQY2td header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=skip.tavakkolian@gmail.com smtp.helo=mail-ot1-f43.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1610781578; bh=eJ7KYk9KDd9fkx2R zD+zXQ63TQChwN7jWkE2wNyJS60=; b=JIlR1f0OWqBEzTudfeSAJCYs6+9OG+0b pqHCh3TYe0vAaQjNFiLBi9XdkS4oKMfkGRyWrFleRjB6qgdyyMZHfkFOOMRpNj5H AJh9DuzZshxnfkOKBcOyI9TujC27/2q50k/UMIcgE1QAsaTzcQ6sSxQB22mQlAMF 61N1ue9OUlw= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1610781578; b=SiafmKSL6aQPSEU5/c3aXh9tW+QmPcKJH5ATF82E8ARcR24iMz h3O06/txpcfcchdi3PUnPQQxuzS6dn0MhmFE6Aw2LOvkaMAsATxAakcA/sCXJVLl fCWYYfHtFRX7LGshYtwcDKGAatzth094OYHCtF+G0L1f4ltrM1E7UzpmQ= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=qgCQY2td header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=skip.tavakkolian@gmail.com smtp.helo=mail-ot1-f43.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=qgCQY2td header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.210.43 (mail-ot1-f43.google.com); spf=pass smtp.mailfrom=skip.tavakkolian@gmail.com smtp.helo=mail-ot1-f43.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=jX3DLzvK; x-ptr=pass smtp.helo=mail-ot1-f43.google.com policy.ptr=mail-ot1-f43.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; bh=YArqvEgiGMWlbmSdUcEZ8dW59mJQlIgyJ9rTpi5y8XA=; b=IZi9u6dY/ntf nJ5ZoRABQYAmyisuoreHLDstJaRcSbTrkwtytGUJ1xNCS4rL1fOevFgnPMOKhQPD LfHxuPy53dsWvy/DJTOiFPL1N1MfRff8qIkJE8ooOb/ElQvNxc4PVoIixH6TA+Ft HnmHTLRIP+Yuu4xwjbeA3GA3x5M7ZK0= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id AD3AB120DBC7 for <9fans@9fans.net>; Sat, 16 Jan 2021 02:19:26 -0500 (EST) (envelope-from skip.tavakkolian@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id F5928256E19; Sat, 16 Jan 2021 02:19:26 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1610781566; b=xwKbUWWjDTdYmHrjkvVXvvFXPa0ksCom4XE3ekFlfX67rrx/Cy gxBOAb6glzSYuNLPWgd1TOnhgNq2JtjLE9mgL2XRgHl/SzKF9+eXzv36yTMaqV9b AdlWzNiEleicV0UqWmQp0eH/gLtLjSX9WKB4gH5Oe9zOvsVQflHVVCe7VZ51Jf/E UKrSRz/GFy3y7Fyncbk5Povt9NIHbFdWcw9zwFL4qaYFUdUMmnv6sBjIcj2EPy1T t+Aik6MyEQjSmrceID1cqwRq/+51w9pZHiHKtx3bEo6jVremlU1+C7otg39kkcyM cL6oYEvHBqjdzpZcUzfoBaN/jRnrc1siOa0w== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1610781566; bh=i6ifhvDWB1Y2IsbqJNtBYBVM6mDI2iSltMX/hCbmO28=; b=qqzBvfxuC0pU udQAe6MZF9f0kx+yulrdG85jiD9Yo2L8XGh17HkhESdvxePW16okq0dpuQI97uOS ty0XH1C5HJYJLhPaNg0YzHbvlotilK5Igk/Q+xujTVn+/7NSPy29X967c3jZdDka kQN5glwu2LoChUwT2cGu+7THE7QKe4UZvX7TRchNfDeZwJDdWF1+lN9kgdFTiv1b 6nGG+W0Tj4YvnN2g6usmn0VtsbHhLt8zsKUj7GrfICxWfA3/0n88aYRcpLjy8Dmb zjSoXIV6MWDY9ARpqaaTtTCXA7JiXZHOkuYspe3k1WYWj8+dPSQSMLjTm0pJQ4nc 5FVL6Ri6ww== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=qgCQY2td header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.210.43 (mail-ot1-f43.google.com); spf=pass smtp.mailfrom=skip.tavakkolian@gmail.com smtp.helo=mail-ot1-f43.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=jX3DLzvK; x-ptr=pass smtp.helo=mail-ot1-f43.google.com policy.ptr=mail-ot1-f43.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrtdefgdelvdculddtuddrgeduhedrtddtmd cutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfhrghsthforghilhdpggftfghn shhusghstghrihgsvgdpuffrtefokffrpgfnqfghnecuuegrihhlohhuthemuceftddtne cunecujfgurhepgghfjgfhfffkuffvtgesrgdtreertddtjeenucfhrhhomhepufhkihhp ucfvrghvrghkkhholhhirghnuceoshhkihhprdhtrghvrghkkhholhhirghnsehgmhgrih hlrdgtohhmqeenucggtffrrghtthgvrhhnpeefjefgjeehudevveetieffkefgjeegvdeh heduudeiteevvdejfeeuudefheduudenucffohhmrghinhepghhithhhuhgsrdgtohhmpd htohhpihgtsghogidrtghomhenucfkphepvddtledrkeehrddvuddtrdegfeenucevlhhu shhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddutddrge efpdhhvghlohepmhgrihhlqdhothduqdhfgeefrdhgohhoghhlvgdrtghomhdpmhgrihhl fhhrohhmpeeoshhkihhprdhtrghvrghkkhholhhirghnsehgmhgrihhlrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'skip.tavakkolian@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="skip.tavakkolian@gmail.com"; helo=mail-ot1-f43.google.com; client-ip=209.85.210.43 Received: from mail-ot1-f43.google.com (mail-ot1-f43.google.com [209.85.210.43]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sat, 16 Jan 2021 02:19:26 -0500 (EST) (envelope-from skip.tavakkolian@gmail.com) Received: by mail-ot1-f43.google.com with SMTP id i20so3136485otl.7 for <9fans@9fans.net>; Fri, 15 Jan 2021 23:19:26 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=i6ifhvDWB1Y2IsbqJNtBYBVM6mDI2iSltMX/hCbmO28=; b=jX3DLzvKq1Z+b7inOXgU1EUMC40DfUsNdVTpPNxOUcc3ubfTRKwHEpHshLfcUUyznC dfcmBVmjTAU6Px2LQYwtw67qZjbsdJ3mw2cvXYK5VTi+jYYDH1qt4fKX3JNcvsbdrC2P nmuoByKH7BwSuQLcGH9VQuBn4phpJkcxHjHqUSrWhLFq8+PjUbEQEGJ0KzXu8dsOkXPN CLzSd2OhhdU1nV3XOumMYQ4yQZZtlX09d2z4c5xEhU21qX/fEup1Dn20Jh8hyO3ga08A ddwCc3brwm+Yw6AJqH5QjmSb7xNg5Hzz36O73Ih2xXm3aJACli3pRv+aoHGC/+EmrHBv DrMg== X-Gm-Message-State: AOAM532YT6zmTzK8DZy781uT+DO8j+mgBC0RCJFK2WZtnbe6gRa9xrZL HpOZ6B+AaRwEBJ5+AppGmQU1u3CGvX5XkUPc+oHOOSdifrg= X-Google-Smtp-Source: ABdhPJyb/XoeNyyXpnwRfUlTcHoNmMbPF6T9ysMCLHxtCcmwUKSssTtwTys4jBdsNs6p3wdHAvRQQ1iXafitMODXjsw= X-Received: by 2002:a05:6830:20c2:: with SMTP id z2mr10685473otq.322.1610781565410; Fri, 15 Jan 2021 23:19:25 -0800 (PST) MIME-Version: 1.0 References: <0100017702d1cdc1-592dbc60-0357-40de-9d00-6310ebd8304e-000000@email.amazonses.com> <0100017703434c67-b7a3d36a-2d2d-42ff-85f8-ac39d964354f-000000@email.amazonses.com> <01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@email.amazonses.com> In-Reply-To: <01000177075cc907-b787910a-bc46-41ef-bac3-2314bc37374a-000000@email.amazonses.com> From: Skip Tavakkolian Date: Fri, 15 Jan 2021 23:19:14 -0800 Message-ID: Subject: Re: [9fans] Plan9 on Raspberry Pi 400? To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="00000000000004658f05b8ff4fb6" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 2e0d38f4-57cb-11eb-9eea-a767c106e12b Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMDE3ODEzMmYzZDJlZDY4OS1NNjM1Y2I0ZTA0ZDZjNGI3NjRjYWI1?= =?UTF-8?B?ZWEyPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M635cb4e04d6c4b764cab5ea2:1:7MrBBU92VYB74BpTwWQP4eerB4z_uOE5MPQW0k5nqZo --00000000000004658f05b8ff4fb6 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable Here's the config.txt that I use for my rpi400 (it's on the file server and handed to rpi via tftp): start_file=3Dstart4cd.elf fixup_file=3Dfixup4cd.dat cmdline=3Dxxxxxxx/cmdline.txt kernel=3Darm/9pi4 gpu_mem=3D16 hdmi_group=3D2 hdmi_mode=3D82 core_freq=3D250 enable_gic=3D1 device_tree=3D On Fri, Jan 15, 2021 at 10:45 AM Mack Wallace wrote: > Dear Skip, > > That pushed the ball forward significantly, but I still have issues. (But > thank you, every little advancement helps.) So with that flag, I was able > to get Richard=E2=80=99s port to boot into Glenda=E2=80=99s account (show= ing acme, faces, > stats, etc). However, I do not seem to have any USB; no mouse; nor > keyboard. Stats is moving on the screen, so things are not too locked up.= I > did try rebooting with an external keyboard and another mouse. Still > nothing. The external keyboard doesn=E2=80=99t respond to anything (no ca= ps lock > nor num lock.) One mouse is in the USB 2.0 port, another and the external > keyboard are in the USB 3.0 ports. > > on boot, I see the following: > usbxhci: 0x1106 0x3483 port 600000000 size 0x1000 irq0 > #u/usb/ep1.0: xhci port 0x0 irq 0 > > The line before is #l for the network, > The line after is the detection of the other three cores. > > The changing of the enable_gic=3D1 on the 9front image seemed to have to > effect. > > Thanks again! > > Mack > > > On Jan 14, 2021, at 8:15 PM, Skip Tavakkolian > wrote: > > > I'm using a RPi400 with Richard's port. I'm netbooting without issues and > up for days. The only issue I had was forgetting to set 'enable_gic=3D1'= as > Richard instructed in the sources. Pi4 works ok without it, pi400 doesn't. > > > On Thu, Jan 14, 2021, 3:39 PM Mack Wallace wrote: > >> Thank you for the reply Stuart, but no luck. >>=20 >> I did download Mr. Miller=E2=80=99s image. It would not boot at all unti= l I >> replaced the files that you mention, but the kernel in that image locks = up >> after detecting the fourth core of the CPU. However, from that failure I >> learned that those files, (start_cd.elf, start4cd.elf, fixup_cd.dat, >> fixup4cd.dat) are necessary for the Pi to boot, and that those with the >> bootcode.bin and presumably, but it doesn=E2=80=99t seem to matter wheth= er I use >> bcm2711-rpi-4-b.dtb or bcm2711-rpi-400.dtb - the dtbs are vital to the >> process. - and that all those files simply need to be copied into the fat >> partition/boot directory. >>=20 >> So I burned another image (actually many, trying different SD cards, and >> different configurations, older kernels, etc) and replaced all the files >> I=E2=80=99ve mentioned with the ones from >> https://github.com/raspberrypi/firmware/tree/master/boot (hopefully >> that=E2=80=99s where I should get them). My most recent iteration just h= as the >> single error repeated: >>=20 >> sdhc: read error intr 2008002 stat 1fff0000 >>=20 >> This occurs many times. In the middle of these errors is >>=20 >> /dev/sdM0: BCM SD Host Controller 02 Version 10 >>=20 >> then the error repeats itself over 50 times before printing out the lines >> /dev/sdM0/data >> bootargs is (tcp, tls, il, local!device)[] >>=20 >> At no time during this process is the keyboard or mouse responsive. >> Though the mouse icon did become visible during the boot process. >>=20 >> I am hoping I am wrong, but I am thinking there is some sort of driver >> issue. At the very least, checking what media there is to mount, or read= ing >> the SD card. And then possibly for other things, but the former could be >> gumming up the works for everything else. >>=20 >> On Jan 14, 2021, at 6:05 PM, Stuart Morrow >> wrote: >>=20 >> Try copying the .dtb *and* the start4 and fixup4. >>=20 > *9fans * / 9fans / see discussions > + participants > + delivery options > Permalink > > ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed689-M635cb= 4e04d6c4b764cab5ea2 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --00000000000004658f05b8ff4fb6 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Here's the config.txt that I use for my rp= i400 (it's on the file server and handed to rpi via tftp):

start_file=3Dstart4cd.elf
fixup_file=3Dfixup4cd.dat
cmdl= ine=3Dxxxxxxx/cmdline.txt
kernel=3Darm/9pi4
gpu_mem=3D16
hdm= i_group=3D2
hdmi_mode=3D82
core_freq=3D250
enable_gic=3D1device_tree=3D


On Fri, Jan 15, 2021 at 10:= 45 AM Mack Wallace <mackbw@map= internet.com> wrote:
Dear Skip,

That pushed the ball forward significantly, but I still have i= ssues. (But thank you, every little advancement helps.) So with that flag, = I was able to get Richard’s port to boot into Glenda’s account = (showing acme, faces, stats, etc). However, I do not seem to have any USB; = no mouse; nor keyboard. Stats is moving on the screen, so things are not to= o locked up. I did try rebooting with an external keyboard and another mous= e. Still nothing. The external keyboard doesn’t respond to anything (= no caps lock nor num lock.) One mouse is in the USB 2.0 port, another and t= he external keyboard are in the USB 3.0 ports. 

=
on boot, I see the following:
usbxhci: 0x1106 0x3483 port 60= 0000000 size 0x1000 irq0
#u/usb/ep1.0: xhci port 0x0 irq 0
<= div>
The line before is #l for the network,
The l= ine after is the detection of the other three cores.

=
The changing of the enable_gic=3D1 on the 9front image seemed to have = to effect.

Thanks again!

<= div>Mack


On Jan 14, 2021, at 8:= 15 PM, Skip Tavakkolian <skip.tavakkolian@gmail.com> wrote:
<= blockquote type=3D"cite">
I'm using a = RPi400 with Richard's port. I'm netbooting without issues and up fo= r days.  The only issue I had was forgetting to set 'enable_gic=3D= 1' as Richard instructed in the sources. Pi4 works ok without it, pi400= doesn't.


On Thu, Jan 14, 2021, 3:39 PM Mack Wallace <mackbw@mapinternet.com> wrote:
= Thank you for the reply Stuart, but no luck.

I did dow= nload Mr. Miller’s image. It would not boot at all until I replaced t= he files that you mention, but the kernel in that image locks up after dete= cting the fourth core of the CPU. However, from that failure I learned that= those files, (start_cd.elf, start4cd.elf, fixup_cd.dat, fixup4cd.dat) are = necessary for the Pi to boot, and that those with the bootcode.bin and pres= umably, but it doesn’t seem to matter whether I use bcm2711-rpi-4-b.d= tb or bcm2711-rpi-400.dtb - the dtbs are vital to the process. - and that a= ll those files simply need to be copied into the fat partition/boot directo= ry.

So I burned another image (actually many, tr= ying different SD cards, and different configurations, older kernels, etc) = and replaced all the files I’ve mentioned with the ones from https://github.com/raspbe= rrypi/firmware/tree/master/boot (hopefully that’s where I sh= ould get them). My most recent iteration just has the single error repeated= :

sdhc: read error intr 2008002 stat 1fff0000

This occurs many times. In the middle of these err= ors is 

/dev/sdM0: BCM SD Host Controller 0= 2 Version 10

then the error repeats itself over = 50 times before printing out the lines
/dev/sdM0/data
b= ootargs is (tcp, tls, il, local!device)[]

At no = time during this process is the keyboard or mouse responsive. Though the mo= use icon did become visible during the boot process. 

=
I am hoping I am wrong, but I am thinking there is some sort of = driver issue. At the very least, checking what media there is to mount, or = reading the SD card. And then possibly for other things, but the former cou= ld be gumming up the works for everything else.

=

On Jan 14, 2021, at 6:05 PM, Stua= rt Morrow <morrow.stuart@gmail.com> wr= ote:

Try copying the .dtb *and* the start4 and fixup4.=

------------------------------------------
9fans: 9fansPermalink: https://9fans.topicbox.com/groups/9fans/T0178132f3d2ed68= 9-M9f2c8a9a58f03931b399b823
Delivery options: https://9fans.topicbox.com/groups/9fans/subscr= iption



= --00000000000004658f05b8ff4fb6--