From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: * X-Spam-Status: No, score=1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,HTML_MESSAGE,MAILING_LIST_MULTI, PDS_OTHER_BAD_TLD,RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H4, RCVD_IN_MSPIKE_WL autolearn=no autolearn_force=no version=3.4.4 Received: (qmail 13342 invoked from network); 20 Sep 2021 11:06:31 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 20 Sep 2021 11:06:31 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 0938B1B44D for ; Mon, 20 Sep 2021 07:06:30 -0400 (EDT) (envelope-from bounce.mM0f2c2ce902355bf729901f86.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id E4FDE4020A52; Mon, 20 Sep 2021 07:06:29 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=G1rghGAx header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=conor.williams@gmail.com smtp.helo=mail-ot1-f53.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1632135989; bh=Woc7X/rXC/ods/B3 aBtudQCTYysotThiZ+EGHbsZHlU=; b=RlmDCRC/5ieiJ7Dn9LW6KJi6HUn1Dpgq h08WjG6Y36srtCvNPEwe3k8OKIzazsbEB7DT7gIOUjhJ1DY/0zZBbxgswlvaiLwl LbY4/WUr+YiTZ4lYUa1N0uYfLUdEG00a6c7iN9fW4Jsi1Hr7hM5XoS2/i0VHPcLq y0L4Nv2xKs0= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1632135989; b=VOiD0ASbRarsJYYFlj0UwbK0gDnk7Dg9qx7AWZjuA9JPdQs6hJ HdFaWUfWqCBjpVmLOieLYQHifR0jwHcrM7VCvsz6zjgEQm9G7SGNWpQQwIe73Idw jKIiuKqlIFdBD/f0tv5YhoP7nbaGxfj6CGRj2KKP4yZIV33sEfoUWzbGU= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=G1rghGAx header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=conor.williams@gmail.com smtp.helo=mail-ot1-f53.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=G1rghGAx header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.210.53 (mail-ot1-f53.google.com); spf=pass smtp.mailfrom=conor.williams@gmail.com smtp.helo=mail-ot1-f53.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=WXq0ixPP; x-me-sender=none; x-ptr=pass smtp.helo=mail-ot1-f53.google.com policy.ptr=mail-ot1-f53.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; bh=eDz++o2g09j2ItT8zxBeaPhY1vh5Y+GBw92sPqh31pM=; b=jjyMCqYl7J7y hOJhpg8ZOhqkUTq482tFnCyO39UhVW7BI5L4ShpPQ/+38rOYxmBGBQRwmRIv45Ae 0wC5ArNiBC+TXv+/IsfyBZ1GrZ1F+R8Gq+aPPmokW85DKUi9oRT5SE2BORYaoNHV dH5SQWYwLDkA8CpVyY2EM/XicX7V2rw= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 53A78416E75F for <9fans@9fans.net>; Mon, 20 Sep 2021 07:06:19 -0400 (EDT) (envelope-from conor.williams@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 3AE75A0E2AF; Mon, 20 Sep 2021 07:06:19 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1632135979; b=pLsx4qSDkGeiC6rAZcduoWoPJIDvsNdWxDXYCqoxsyYvicNapP vf1PegwDgIhFJXtNRXr9c2a3fDZexf1OOyL1QMDKJU3ZHTfh4U+0QFaoyuRb3YBS PeW6V/b2oe8eqXTRnroXSrjXrP4x2EFhSn0zv8NJ8QTqXISYEsl9H6q9Eh4cTLrZ i6IJtTUtJtsFnQl1JaQQaDfKGCSP9iLULOngF4a85AwCV89YJtJbuD3NrWCYOwRF 5fljTxQM/d6sqEcqJimMwfujua73zsD+aVTtwdo4T4UmAYPA/G7qvrMa2feFmXQB 6wysd9yiUGc8DV6AFuJq84Zt05EfUKfMszog== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1632135979; bh=DoECJdV8FL6LwzBTjPOeQe1hrgVf7Q25Zwzl8y0WvfA=; b=V6o4PzSy7V2e 9IwHlnnTZ4oEzkQDGaLkytBQavh2ixzc6fmV5U8KRtGUAr9sjgEdzmEu+f+lfW60 uKDoS5oSOu7r7RePQaYHXbtQFGOFghlztI9EC0i8GgZmaBn52/yGVCpTEt+aWsr2 hjDzpPiHX1ipiyvWxschOjhO5I1FAchnmXqN+CJKzjKXrHhddt92IojTC/ucWhMe aQfmKPb9xEve+6Nctsp7gbcjXyhxAPW6wDNfxHRPQxW4QJrdpUCc19FOtb0dbn8k HNguDAwL9JMhRiox/85WNa17f+ahp/LqewOKzez6swZlHMWUm3jsTuxuWYWZ7fnL IoMDCwHf+A== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=G1rghGAx header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.210.53 (mail-ot1-f53.google.com); spf=pass smtp.mailfrom=conor.williams@gmail.com smtp.helo=mail-ot1-f53.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=WXq0ixPP; x-me-sender=none; x-ptr=pass smtp.helo=mail-ot1-f53.google.com policy.ptr=mail-ot1-f53.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvtddrudeivddgfeeiucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf ffkffuvfgtsegrtderredttdejnecuhfhrohhmpeevohhnohhrucghihhllhhirghmshcu oegtohhnohhrrdifihhllhhirghmshesghhmrghilhdrtghomheqnecuggftrfgrthhtvg hrnhepueekfeeutdefgefhffetfeevvdeiueettdfffefhvdffteevfefggeehfedutefg necuffhomhgrihhnpegtmhhurdgvughupdhoshguvghvrdhorhhgpdhgihhthhhusgdrtg homhdpthhophhitggsohigrdgtohhmnecukfhppedvtdelrdekhedrvddutddrheefnecu vehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvud dtrdehfedphhgvlhhopehmrghilhdqohhtuddqfhehfedrghhoohhglhgvrdgtohhmpdhm rghilhhfrhhomhepoegtohhnohhrrdifihhllhhirghmshesghhmrghilhdrtghomheq X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'conor.williams@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="conor.williams@gmail.com"; helo=mail-ot1-f53.google.com; client-ip=209.85.210.53 Received: from mail-ot1-f53.google.com (mail-ot1-f53.google.com [209.85.210.53]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Mon, 20 Sep 2021 07:06:18 -0400 (EDT) (envelope-from conor.williams@gmail.com) Received: by mail-ot1-f53.google.com with SMTP id c6-20020a9d2786000000b005471981d559so1532730otb.5 for <9fans@9fans.net>; Mon, 20 Sep 2021 04:06:18 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=DoECJdV8FL6LwzBTjPOeQe1hrgVf7Q25Zwzl8y0WvfA=; b=WXq0ixPPTcHjq9xPlkS9/0fgXwTRWFJIBGup1ghoZtJgAN/l/75dXGe9v5TXBVUvlE teJmmZ+2eKdZ56CrMv2an4E27+vmIVarxBKqYOTcJeWCenO9NthBuXJG2Ckk6FYxDuFc Au69VFN96XlF6ZVXYJOn+0zPHPUFlvBDBnCZnOdQblpyTtj3ZU3ADsNZl54t6kRKIs95 yxX2SQ1Zn1UqXcvr5oqI4mn4L2goH8hKusWVT44ZKnIhW1X+qZETC5xFXKvMOaTus4Z8 G+E9KF9jDJj75/e+ScVMw+sLRdS+g8n0O3MZr418KM5ilkD0aKbRMCxwkxwTTsYLrTJn zDlQ== X-Gm-Message-State: AOAM533v+YAji0kvLnFHAd4JuVPFbe7cVarxcPTzOOfzhW2y88Uk6yGF ZuGJgEWsbPNaDBZ7q+/URSg0ASf4pb9rL9hP96hYT2R0Y/9mfO4/ X-Google-Smtp-Source: ABdhPJwgy1JusdStFY2QyyKgVZPA36tX+vr1+FRynd33U4wvAE51mgX/c+AW47q1lIgGIS9ffsweifh6XvO6wYDc8Dw= X-Received: by 2002:a9d:7ac9:: with SMTP id m9mr21485439otn.244.1632135977930; Mon, 20 Sep 2021 04:06:17 -0700 (PDT) MIME-Version: 1.0 References: <15937.1632116621@lunacy.ugrad.cs.cmu.edu> <565ccec9-0efb-45ad-9d08-dbfe6ed35bd5@www.fastmail.com> In-Reply-To: From: Conor Williams Date: Mon, 20 Sep 2021 11:06:05 +0000 Message-ID: Subject: Re: [9fans] GSoC 2021 project ideas To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="00000000000030923205cc6b45b4" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: caf82634-1a02-11ec-9e4e-c9422153809a Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UMzlhZWM4ZjNmOWQ4NTAzZC1NMGYyYzJjZTkwMjM1NWJmNzI5OTAx?= =?UTF-8?B?Zjg2Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M0f2c2ce902355bf729901f86:1:N23Z0vKKLR8uJfkEm_pz9lPmTpOLzJZM3zTH7njSgVU --00000000000030923205cc6b45b4 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable ethan you think your no-one driver/mobule is not too bad i also something something something /c2021081105:37 On Mon, Sep 20, 2021 at 8:58 AM Conor Williams wrote: > and dr john nelson in University Limerick -- a fine reputable uni down > south ireland (with > loads of good professor types and students (most of them anyways) > stole my fyp and bought me lunch and said nothing about nothing and then > told me to > fuck off over the phone when i was enquiring about doing a phd which i wi= ll > and has links into the psychaitric system and they keep locking me up to > hide their slimy pasts > and that my friends is not the end of that parrticular conundrum... keep > posted on irc... will let > u know what channel /c:202109200858:51 > > On Mon, Sep 20, 2021 at 8:52 AM Conor Williams > wrote: > >> and tim roberts on an unrelated topic is a bunch of un-ethical hackers >> diminishing the intellect of the humanity /c:202109200851 >> hack the planet my fiends... >> >> On Mon, Sep 20, 2021 at 8:45 AM Conor Williams >> wrote: >> >>> i figured out the random hack which messed me up 12 years ago 2 days ago >>> /c:f20 >>> and the buda bug is fixed on my system - took me 3 days strait to find >>> it... >>> and the fuseblk hack took a while /c:2021 >>> >>> On Mon, Sep 20, 2021 at 8:39 AM Conor Williams >>> wrote: >>> >>>> if it is a vfat filesystem it is ok.... >>>> >>>> On Mon, Sep 20, 2021 at 8:37 AM Conor Williams < >>>> conor.williams@gmail.com> wrote: >>>> >>>>> some of the fuseblk disc/k drivers/modules on peppermint which is a >>>>> flavour of ubuntu >>>>> are not even in the kernel space and there are mount.XYZ processes >>>>> left open which are >>>>> wide open to attack (with # fuser -p ) /c09 >>>>> for those chips tings >>>>> >>>>> On Mon, Sep 20, 2021 at 8:24 AM hiro <23hiro@gmail.com> wrote: >>>>> >>>>>> i think the main reason people are willing to fall for the android >>>>>> platform is bec. there is no good long-term supply of updated phone >>>>>> hardware with backwards-compatible interfaces. >>>>>> >>>>>> a lot of qualcomm and mediatek chipsets are being built, but instead >>>>>> of documentation they only ship half-baked linux drivers, which are >>>>>> often not even mainlined. >>>>>> >>>>>> those linux drivers are already hard to make work on actual linux >>>>>> distributions, or even on android distributions. >>>>>> >>>>>> who wants to reverse-engineer the hardware over and over again based >>>>>> on such linux drivers... >>>>>> >>>>>> On 9/20/21, Ethan Gardener wrote: >>>>>> > tl;dr: forget inferno, port plan 9 to the pine phone. >>>>>> > >>>>>> > On Mon, Sep 20, 2021, at 6:43 AM, Dave Eckhardt wrote: >>>>>> >> > Anyone know if this project went anywhere? >>>>>> >> > >>>>>> >> > https://www.cs.cmu.edu/~412/lectures/L05_Purge_Proposal.pdf >>>>>> > >>>>>> > I had to laugh at one of the slides. Inferno running natively on >>>>>> "x86 >>>>>> > supercomputer"? I think implementing multicore support would be a >>>>>> first >>>>>> > step, not to mention 64-bit! While it would be nice if those jobs >>>>>> were done, >>>>>> > they will take time and effort. Overall, if porting natively, I see >>>>>> little >>>>>> > sense in preferring Inferno to Plan 9, especially as Plan 9 already >>>>>> supports >>>>>> > 64-bit multicore. >>>>>> > >>>>>> >> Sadly, not. One issue is that modern Android releases don't >>>>>> >> support 32-bit executables, and at the time that project was >>>>>> >> attempted Inferno was somewhat 32-bit (I haven't looked since). >>>>>> > >>>>>> > Recalling the issues Hellaphone had and the time it took, I'm of >>>>>> the opinion >>>>>> > that getting Inferno to work on any given phone's Linux kernel is >>>>>> hardly >>>>>> > more worthwhile than porting it directly to the hardware. The >>>>>> kernels have >>>>>> > undocumented interfaces. >>>>>> > >>>>>> > A current thread on OSdev (operating system development) forums is >>>>>> looking >>>>>> > at phones. It's a little rambly, but it reports on some encouraging >>>>>> things. >>>>>> > Lots of "baseband processors" (the phone-network communication >>>>>> subsystems) >>>>>> > have documented interfaces. There are at least 2 phones available >>>>>> now which >>>>>> > are fully open for operating system development: the PinePhone and >>>>>> the >>>>>> > Librem 5. (5 is the screen size.) Of the 2, the Pine Phone seems >>>>>> better, not >>>>>> > least because it can boot from the SD card; useful for testing. >>>>>> > https://forum.osdev.org/viewtopic.php?f=3D1&t=3D53251 >>>>>> > >>>>>> > There's also the option of building your own phone out of >>>>>> components. The >>>>>> > thread has some info. I'm guessing most here would prefer a >>>>>> PinePhone. >>>>>> >> But I think I saw some recent-ish Inferno-on-Android activity her= e: >>>>>> >> >>>>>> >> https://github.com/bhgv/Inferno-OS-bhgv >>>>>> > >>>>>> > That's probably a good source of code. bhgv is a freelance >>>>>> programmer who >>>>>> > was very interested in Inferno and made several improvements >>>>>> including >>>>>> > Truetype fonts. The last I heard was he tried to find paid work >>>>>> involving >>>>>> > Inferno but couldn't, so he didn't have time to work on it. >>>>>> >>>>>> ------------------------------------------ >>>>>> 9fans: 9fans >>>>>> Permalink: >>>>>> https://9fans.topicbox.com/groups/9fans/T39aec8f3f9d8503d-M0f66e73ea= 984adbad982f776 >>>>>> Delivery options: >>>>>> https://9fans.topicbox.com/groups/9fans/subscription >>>>>> ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T39aec8f3f9d8503d-M0f2c2= ce902355bf729901f86 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --00000000000030923205cc6b45b4 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
ethan you think your no-one driver/mobule= is not too bad
i also something something something /c2021081105= :37

On Mon, Sep 20, 2021 at 8:58 AM Conor Williams <conor.williams@gmail.com> wrote= :
and dr john nelson in University Limerick -- a fine reputable uni= down south ireland (with
loads of good professor types and stude= nts (most of them anyways)
stole my fyp and bought me lunch= and said nothing about nothing and then told me to
fuck o= ff over the phone when i was enquiring about doing a phd which i will
=
and has links into the psychaitric system and they keep locking me up = to hide their slimy pasts
and that my friends is not the end of t= hat parrticular conundrum... keep posted on irc... will let
u know what channel /c:202109200858:51

On Mon, Sep 20, 2021= at 8:52 AM Conor Williams <conor.williams@gmail.com> wrote:
and tim r= oberts on an unrelated topic is a bunch of un-ethical hackers
dim= inishing the intellect of the humanity /c:202109200851
hack the p= lanet my fiends...

On Mon, Sep 20, 2021 at 8:45 AM Conor Willi= ams <conor= .williams@gmail.com> wrote:
i figured out the random hack wh= ich messed me up 12 years ago 2 days ago /c:f20
and the buda bug = is fixed on my system - took me 3 days strait to find it...
and t= he fuseblk hack took a while /c:2021

On Mon, Sep 20, 2021 at 8= :39 AM Conor Williams <conor.williams@gmail.com> wrote:
if it is a vfat fil= esystem it is ok....

On Mon, Sep 20, 2021 at 8:37 AM Conor Williams= <conor.wi= lliams@gmail.com> wrote:
some of the fuseblk disc/k drivers/= modules on peppermint which is a flavour of ubuntu
are not even i= n the kernel space and there are mount.XYZ processes left open which are
wide open to attack (with # fuser -p <PID>) /c09
fo= r those chips tings

On Mon, Sep 20, 2021 at 8:24 AM hiro <<= a href=3D"mailto:23hiro@gmail.com" target=3D"_blank">23hiro@gmail.com&g= t; wrote:
i th= ink the main reason people are willing to fall for the android
platform is bec. there is no good long-term supply of updated phone
hardware with backwards-compatible interfaces.

a lot of qualcomm and mediatek chipsets are being built, but instead
of documentation they only ship half-baked linux drivers, which are
often not even mainlined.

those linux drivers are already hard to make work on actual linux
distributions, or even on android distributions.

who wants to reverse-engineer the hardware over and over again based
on such linux drivers...

On 9/20/21, Ethan Gardener <eekee57@fastmail.fm> wrote:
> tl;dr: forget inferno, port plan 9 to the pine phone.
>
> On Mon, Sep 20, 2021, at 6:43 AM, Dave Eckhardt wrote:
>> > Anyone know if this project went anywhere?
>> >
>> > https://www.cs.cmu.edu/~412= /lectures/L05_Purge_Proposal.pdf
>
> I had to laugh at one of the slides. Inferno running natively on "= ;x86
> supercomputer"? I think implementing multicore support would be a= first
> step, not to mention 64-bit! While it would be nice if those jobs were= done,
> they will take time and effort. Overall, if porting natively, I see li= ttle
> sense in preferring Inferno to Plan 9, especially as Plan 9 already su= pports
> 64-bit multicore.
>
>> Sadly, not.  One issue is that modern Android releases don= 9;t
>> support 32-bit executables, and at the time that project was
>> attempted Inferno was somewhat 32-bit (I haven't looked since)= .
>
> Recalling the issues Hellaphone had and the time it took, I'm of t= he opinion
> that getting Inferno to work on any given phone's Linux kernel is = hardly
> more worthwhile than porting it directly to the hardware. The kernels = have
> undocumented interfaces.
>
> A current thread on OSdev (operating system development) forums is loo= king
> at phones. It's a little rambly, but it reports on some encouragin= g things.
> Lots of "baseband processors" (the phone-network communicati= on subsystems)
> have documented interfaces. There are at least 2 phones available now = which
> are fully open for operating system development: the PinePhone and the=
> Librem 5. (5 is the screen size.) Of the 2, the Pine Phone seems bette= r, not
> least because it can boot from the SD card; useful for testing.
> https://forum.osdev.org/viewtopic.php?= f=3D1&t=3D53251
>
> There's also the option of building your own phone out of componen= ts. The
> thread has some info. I'm guessing most here would prefer a PinePh= one.
>
>> But I think I saw some recent-ish Inferno-on-Android activity here= :
>>
>>   https://github.com/bhgv/Inferno-OS-bhgv<= /a>
>
> That's probably a good source of code. bhgv is a freelance program= mer who
> was very interested in Inferno and made several improvements including=
> Truetype fonts. The last I heard was he tried to find paid work involv= ing
> Inferno but couldn't, so he didn't have time to work on it.
------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/T39aec8f3f9d8503d-M0f66e73ea984adbad982f7= 76
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription
= --00000000000030923205cc6b45b4--