From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 7E9A7482710C for <9fans@9fans.net>; Wed, 25 Mar 2020 02:40:14 -0400 (EDT) (envelope-from cyberfonic@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id C1A233640F1; Wed, 25 Mar 2020 02:40:14 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1585118414; b=LArba0kZZ4AkPc/hUcI6rMkTfdZCAOwGsBZdmc5vUs+UM+y4iD PCt84dFiM4P0ho2GzPQdXcUT3YhltLevbvrriZ3Ai7LrHnh1vJUwUM2F1uIDroB3 q/Qkzdg2FqnB65IBfexZreBF2x88eiJxG/PCwzP+/u+yQdTzJDzzNErCaeHy+Kqm YwbEtqmLOseNWmZsYxf86NmbbewxXA3HdjNzeIIrQrJavDXEFlQBrJPZLW3+m+6n w2TCYw+sCjngMnNlpNzbr/T2MFjlpKia0xIP858PUhldUr2i4slVzzkbBzUO3k02 8tc/Y0Thn/Uue3DGRbfyjztTtE3laKraKoeQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1585118414; bh=b6J5VtPsGAwxMNSZa5kgCrP503g0fWQsE5YR7Px2IAI=; b=AFnznyj0/T7M hMUDP6EgCEgKHJN+7KaMFDc6woexIdzEgtoEspFZYv4/PW3WTMamz19uqYayq7NW RyRdX/nk7/uagPzREa2QmEB3Y0hI8tCEAo2xVEVp8PmBmFfSmOPc7wPn1VohCAKR elJnGj1lgphJFFeN0DiLFE9VHW5adSVwqsDFnyOhrO7p1ZusKyiVfDywNhvTtxHi 2oVLrHc27BHEA9e7i7CIHJEMvVwsgaieT/8b/sAYIATkHSUn/lxmGtgbAg7JepoC Ntc1s4IHvGfyMyTMoxQeGUY5wobzUTyJniOzRDPDIXHETcPCCaRxji4DITQNFB/c AFK2nBixcw== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=nNwqmZyL header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.210.44 (mail-ot1-f44.google.com); spf=pass smtp.mailfrom=cyberfonic@gmail.com smtp.helo=mail-ot1-f44.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=I1USU75i; x-ptr=pass smtp.helo=mail-ot1-f44.google.com policy.ptr=mail-ot1-f44.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=49 state=0 Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=nNwqmZyL header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.210.44 (mail-ot1-f44.google.com); spf=pass smtp.mailfrom=cyberfonic@gmail.com smtp.helo=mail-ot1-f44.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=I1USU75i; x-ptr=pass smtp.helo=mail-ot1-f44.google.com policy.ptr=mail-ot1-f44.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt4.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=49 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedugedrudehvddgleejucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhushhpvggtthffoh hmrghinhculdegledmnecujfgurhepgghfjgfhfffkuffvtgesrgdtreertddtjeenucfh rhhomhepveihsggvrhcuhfhonhhitgcuoegthigsvghrfhhonhhitgesghhmrghilhdrtg homheqnecuffhomhgrihhnpehsfihttghhrdgtohhmpdelphdrihhopdhtohhpihgtsgho gidrtghomhenucfkphepvddtledrkeehrddvuddtrdeggeenucevlhhushhtvghrufhiii gvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddutddrgeegpdhhvghlohep mhgrihhlqdhothduqdhfgeegrdhgohhoghhlvgdrtghomhdpmhgrihhlfhhrohhmpeeotg ihsggvrhhfohhnihgtsehgmhgrihhlrdgtohhmqecuuffkkgfgpeekheegvd X-ME-VSScore: 49 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'cyberfonic@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="cyberfonic@gmail.com"; helo=mail-ot1-f44.google.com; client-ip=209.85.210.44 Received: from mail-ot1-f44.google.com (mail-ot1-f44.google.com [209.85.210.44]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 25 Mar 2020 02:40:14 -0400 (EDT) (envelope-from cyberfonic@gmail.com) Received: by mail-ot1-f44.google.com with SMTP id a6so949205otb.10 for <9fans@9fans.net>; Tue, 24 Mar 2020 23:40:14 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:references:in-reply-to:from:date:message-id:subject:to; bh=b6J5VtPsGAwxMNSZa5kgCrP503g0fWQsE5YR7Px2IAI=; b=nNwqmZyLQWJrzO+9P5oYLd2/5ca6IzlUu90N+AAPF5u2Um4x44/+vqNAYhsgF8i7Gx FsxHN9Px3sS/Ry/Ku5uxbAM5hLuJm5nuEAeuuXbrvo9nkA3ww/qNWO6LGNmhMcPubMw5 lahbskFEGAXSJSsRyWSN8AAdi7s4ELbRPD0JOGrWFnk7VS+bjt5k7LD75ieGDsZ+EDV3 M2BGd+xh/Iv5dc2K96MzCorVrVW6hU8e5UkU05crvIT0GRUCVeDTm1UW4fmQNLxfVBxu 8DH1/mP73aV4G2qlvXE+8CeVRBZCMo0iIIwwf9U2Q49Y4YB4O8xa6Elh39rc3eTwqh2v YyJQ== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=b6J5VtPsGAwxMNSZa5kgCrP503g0fWQsE5YR7Px2IAI=; b=I1USU75i2PvR1r802g4wi5pNksSk5rsAEM9pd6eIRWj42LAygxtu38jUGDg9KnDVUM PuXLUc9xowv3Ouka7p/nvsLESIP+zP17xGJWvkllxc7hyLlNLzocaJJ9MnkZ71REAwDd U73PEN07gND+ssQwihJsYKFVd3RWtmshE3URgw9rtYBz0oasPer/0301lb+xLgaxDA9n mgLIZYVYoa6//stVTk6m/7ZfeudJpdAfL+gMi3P1X/sQhW3dD1W5zkwSFHKnuBjeVEgz LR2ckccpa1xoxFn8kCMp9UY4CqEU7Epsas8Tc6+lKvRd8uvcC6OlmFimcm+edJkYykcH fEqw== X-Gm-Message-State: ANhLgQ1Tx1REXPfCB4TBQk/lo3oMrW8gIFZ03OzKjHTD6vGot+yELpau +neWetKmwNFXV7J5tofqYjzn5O7Xy8t90iAerMp0kwpgeNw= X-Google-Smtp-Source: ADFU+vvODDoJssvnX/n3my7+WHZOTRMJ0X3/SpuJDn7fot98w6usDFLatrhM1QW+GmKgUGHc/Ucf434TD5OMaZCKTF0= X-Received: by 2002:a4a:8241:: with SMTP id t1mr606850oog.57.1585118413267; Tue, 24 Mar 2020 23:40:13 -0700 (PDT) MIME-Version: 1.0 References: <15838110370.EA8c2.229460@composer.9fans.topicbox.com> <527DF2F5-4EB1-48E7-B253-8CA2E86D6FAD@gmail.com> In-Reply-To: <527DF2F5-4EB1-48E7-B253-8CA2E86D6FAD@gmail.com> From: Cyber Fonic Date: Wed, 25 Mar 2020 17:39:57 +1100 Message-ID: Subject: Re: [9fans] Plan9 on virtual machine in Mac os To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="000000000000f326e605a1a823eb" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 7e8ec47a-6e63-11ea-ab86-af34ce9ad179 --000000000000f326e605a1a823eb Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I have been using Russ Cox's 9vx on OS/X Mavericks with considerable success. The only issue being that I need to connect a Logitech 3 button mouse via a Unifying RF dongle (BlueTooth mice don't work for me). Although 9vx is somewhat minimal, I download sources as I require them from 9p.io website . Richard Millers Plan9 port works fine for me on an older RPi - B (?) using the same mouse that I use with MBP. Personally I find the 9vx environment more to my liking as I can edit code with vim, use Finder, etc using OS/X concurrently with Plan9 -- yes, I know that is heretical to die-hard Plan9 folks, but I'm a *nix guy foremost and a Plan9 newbie. Pardon the confusion over which model RPi I am using. I have several from different releases and I get confused as to which one I am using at any given time. Swapping SDHC cards, etc On Wed, 25 Mar 2020 at 12:33, Mark Everett wrote: > Mostly a lurker so far, but wanted to try the actual system rather than > plan9port. But sometimes getting actual hardware up an running is a stee= p > first step :-) > > Does anyone know of a virtual machine running on current Mac OS that host= s > plan9? Preferably one that isn=E2=80=99t too difficult to set up=E2=80= =A6. > > Also, I=E2=80=99m a little unclear on what the advantages/disadvantages o= f the > various forks of plan9 are best on, their audience, etc. And it seems > somewhat difficult to determine where to find the code for the different > forks. Most likely I=E2=80=99m just not paying attention=E2=80=A6. > > I do have a pi 4 but probably not the one with the wall wart fix. Is Mr. > Miller=E2=80=99s code all in one place? Where is it publicly available? > > Is there some repository for add-on file systems ala 9P2000 in one place. > If not the actual code, perhaps pointers to the actual repositories. > > Sorry if it appears that I=E2=80=99m not digging in to find this informat= ion > myself, but I can=E2=80=99t seem to find the end of the string to pull=E2= =80=A6 > > Thanks in advance. > > Lurker Mark > > > > ------------------------------------------ > 9fans: 9fans > Permalink: > https://9fans.topicbox.com/groups/9fans/Ta7f245368d4d10b8-M36019cd786241b= aabf231844 > Delivery options: https://9fans.topicbox.com/groups/9fans/subscription > --000000000000f326e605a1a823eb Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
I have been using Russ = Cox's 9vx=C2=A0on OS/X Mavericks with considerable success.=C2=A0 T= he only issue being that I need to connect a Logitech 3 button mouse via a = Unifying RF dongle (BlueTooth mice don't work for me).

Although 9vx is somewhat minimal, I download sources as I require them f= rom 9p.io website.

Richard Millers Plan9 port works fine for me on an older RPi - B (= ?)=C2=A0 using the same mouse that I use with MBP.

Personally I find the 9vx environment more to my liking as I can edit code= with vim, use Finder, etc using OS/X concurrently with Plan9 -- yes, I kno= w that is heretical to die-hard Plan9 folks, but I'm a *nix guy foremos= t and a Plan9 newbie.

Pardon the confusion over wh= ich model RPi I am using. I have several from different releases and I get = confused as to which one I am using at any given time. Swapping SDHC cards,= etc=C2=A0



On Wed, 25 Mar 2020 at 12:33,= Mark Everett <everettm@gmail.com<= /a>> wrote:
M= ostly a lurker so far, but wanted to try the actual system rather than plan= 9port.=C2=A0 But sometimes getting actual hardware up an running is a steep= first step :-)

Does anyone know of a virtual machine running on current Mac OS that hosts = plan9?=C2=A0 Preferably one that isn=E2=80=99t too difficult to set up=E2= =80=A6.

Also, I=E2=80=99m a little unclear on what the advantages/disadvantages of = the various forks of plan9 are best on, their audience, etc. And it seems s= omewhat difficult to determine where to find the code for the different for= ks. Most likely I=E2=80=99m just not paying attention=E2=80=A6.

I do have a pi 4 but probably not the one with the wall wart fix. Is Mr. Mi= ller=E2=80=99s code all in one place? Where is it publicly available?

Is there some repository for add-on file systems ala 9P2000 in one place. I= f not the actual code, perhaps pointers to the actual repositories.

Sorry if it appears that I=E2=80=99m not digging in to find this informatio= n myself, but I can=E2=80=99t seem to find the end of the string to pull=E2= =80=A6

Thanks in advance.

Lurker Mark



------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/Ta7f245368d4d10b8-M36019cd786241baabf2318= 44
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription
--000000000000f326e605a1a823eb--