From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE,RCVD_IN_MSPIKE_H3,RCVD_IN_MSPIKE_WL autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 17119 invoked from network); 25 Jan 2022 19:44:46 -0000 Received: from tb-ob0.topicbox.com (64.147.108.117) by inbox.vuxu.org with ESMTPUTF8; 25 Jan 2022 19:44:46 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob0.topicbox.com (Postfix) with ESMTP id 4B170363EF for ; Tue, 25 Jan 2022 14:44:45 -0500 (EST) (envelope-from bounce.mM65074e1fd15136edda09daa5.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 46584132615C; Tue, 25 Jan 2022 14:44:45 -0500 (EST) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=TOiK4GDf header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=tolstoyclout@gmail.com smtp.helo=mail-ua1-f52.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1643139885; bh=RJ+3U3wDWA7vJXup f7kfHW8OSuh3BUElfSxmBrh/L9U=; b=KydKWixp5P03Uw8FT79xQybRHkKqH1a4 yFEaN0xsD/NpWBzOMUDslRFQxVDSWqJMT6KOhTRUN6o/Ie4amGKYKsP5vh7AFnTr /PQUEYwY+CGOn/ju1mPdqYQwT6GBA1AEKuU03mn9v8luanbUz8DvBKDoVnDVoPk4 uxQHEhUGFG8= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1643139885; b=NVKO02GhHbTMgyVopz3BIq5zIY/zRwZjku8kvgez9WoJ7dKdQ0 C85UBkrVdYVX22krlvP4GGRI8y/LVMpkMwLoSgXmwIPbXYceLgwq1pL+fTJ2xg2h xE/b14oKrZQ4wnl6DMU2sKIlHguYr30OXXVsirTJv3vmt/JFYt9+DhShg= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=TOiK4GDf header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=tolstoyclout@gmail.com smtp.helo=mail-ua1-f52.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=TOiK4GDf header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.222.52 (mail-ua1-f52.google.com); spf=pass smtp.mailfrom=tolstoyclout@gmail.com smtp.helo=mail-ua1-f52.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=sn0x068e; x-me-sender=none; x-ptr=pass smtp.helo=mail-ua1-f52.google.com policy.ptr=mail-ua1-f52.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; bh=oUaDqDcRLUhkvbM+Zcg6fFs3kpylK0wtEb2gkSTrkOg=; b=cH1LecUpNbKR 3CdMNtxA1xvT5FWU2dH4MTeM2/bZKnpTlhJErf/a5Zix7uF2CLawlOm9z1cpJ9Gq s9q261Z9hM8Oxt8/lN8BxF62rR2gMuXzIiQgvLx8zgkBU71SM/apl90Fhj25ST5U K+YwUVaTrdvX89kqP9vZFKnRGRrM9yo= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id AEDFAF4B1CB for <9fans@9fans.net>; Tue, 25 Jan 2022 14:44:34 -0500 (EST) (envelope-from tolstoyclout@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 85CC8FD143F; Tue, 25 Jan 2022 14:44:34 -0500 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1643139874; b=Gvcc+KhjclS2GTfYQ5lpfHw8Npm5YE9Kq592tC966t0l6jofAA BTuoMhMN5XDcImzsRWfLwg3f3FvNrOdqpjRD9724ptJOSW3FZQ1LKkckDnZwsYN7 JpzJ7sh+OC1bScO8gwUh+p9DXCOjDNJajkZobvjVhRNzqNs4vdrp7BfmAtLnQUql GRe6hfEPXupKDHqQ7DNwaatolmL3xw2YIm851m0IkRAqLoiSdNA37ylEdbQK1rgL P9hf4IyUO/X1piUC63+0CToleUzjS6Paa+eyUpCILUGu1HfG+0ShV/SR5BrrsyXf BlSVt7Y3xjHnnKM22YLfyhhk3f4ILf/7i+hQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1643139874; bh=GNA7Tfymz6Kj6JFzsjBH8if5Ng4X/Eaenqet0JR882g=; b=JIBEoCTTr+/H lkkqQeoG7qC6egFATUIW5YIvSzedBVs9s1V89qMd7xXGECeSXa3qKP0hdMEWySyA iVnCrCKpi6ouTsT+60vYEu5hFgTyC8r3JYSOLojURQ7RM4/7/IlI8GEAYJAsEZ3A Ca8PIDWYBsgl58p42Z+NusLSMstHAMSo4fo7869WKkTU8gAwioiki0pATGouJLmP iTcVj4HoyQTZz/Vz7aQlZEFX8Yq6Jj888w+VIVn0ce9Qng/TucPFpqq9FhUWw3B8 j9H2FdigIWzdyWMRxvYz8LpRXlQ5JWvpMSke0xp8TAiNeC2Nj8yLoJBJ+O5mZiQ7 3x+ZcZeV4w== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=TOiK4GDf header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.222.52 (mail-ua1-f52.google.com); spf=pass smtp.mailfrom=tolstoyclout@gmail.com smtp.helo=mail-ua1-f52.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=sn0x068e; x-me-sender=none; x-ptr=pass smtp.helo=mail-ua1-f52.google.com policy.ptr=mail-ua1-f52.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvvddrvdehgdduvdeiucdltddurdegudelrddttd dmucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgf nhhsuhgsshgtrhhisggvpdfurfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttd enucenucfjughrpeggfhgjhfffkffuvfgtsegrtderredttdejnecuhfhrohhmpeevlhho uhhtucfvohhlshhtohihuceothholhhsthhohigtlhhouhhtsehgmhgrihhlrdgtohhmqe enucggtffrrghtthgvrhhnpedtlefhteetueeiieekveegjeefjeehhfehlefgudffteeh hedvtdffvefgkeetudenucffohhmrghinhepfihhrghtihhsrghuthhhvghnthhitghith ihrdgtohhmpdhtohhpihgtsghogidrtghomhenucfkphepvddtledrkeehrddvvddvrdeh vdenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhe drvddvvddrhedvpdhhvghlohepmhgrihhlqdhurgduqdhfhedvrdhgohhoghhlvgdrtgho mhdpmhgrihhlfhhrohhmpeeothholhhsthhohigtlhhouhhtsehgmhgrihhlrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'tolstoyclout@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="tolstoyclout@gmail.com"; helo=mail-ua1-f52.google.com; client-ip=209.85.222.52 Received: from mail-ua1-f52.google.com (mail-ua1-f52.google.com [209.85.222.52]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Tue, 25 Jan 2022 14:44:34 -0500 (EST) (envelope-from tolstoyclout@gmail.com) Received: by mail-ua1-f52.google.com with SMTP id p7so32181262uao.6 for <9fans@9fans.net>; Tue, 25 Jan 2022 11:44:34 -0800 (PST) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=GNA7Tfymz6Kj6JFzsjBH8if5Ng4X/Eaenqet0JR882g=; b=sn0x068e4+/FnO9E3EAxXLG/pbMf4xNWmqfyeZKOw8eXyu3LBxTCd/flcGZmhbEoVM vSsHmjnFtRrRWjldH96vQbxDvMkGeFOrTRnP2XUDLfVlhHHdEi2x4vUpgxSMMAd2XB1t 1R/S4/joBErCGuR64RwqNoLiBuEMx0nA8YQ/2mnQDN8YCNyFkEzn5qgB6tG0KdZntGxa AyzdAp1kQCJy3bJM6s/mwMMXzz8SMZFLRyXjaDzK/ZRyLZdwd8LPtiz5lYdHmUP/pNIA LSNjy2tjJzcdCA8qHdRuOT10p1XKsYlyolocTIlQRGW7+/SJFAPhvPWpA8HCI/zuEC1v jxNA== X-Gm-Message-State: AOAM531uzNTB8Symzh/qo4UL7I3oXXZG4kjB/r6H6maAA9TVjFdN6i5Z Rsc+M27r/TVkgGviIH2FGE8jkD8FW1ZAHYJ6G9EERbe8 X-Google-Smtp-Source: ABdhPJy4Vb9LOV5TLM4gD+G3HAZV79eMXXFwINYWS2JsWuhVM4Nipiyi4wSSfFS3bU56xUl3sbaZnBbWF0Qy8YvSh1s= X-Received: by 2002:a67:c19e:: with SMTP id h30mr1898822vsj.15.1643139873436; Tue, 25 Jan 2022 11:44:33 -0800 (PST) MIME-Version: 1.0 References: <7b602756-a2e7-89e8-53f3-c569a3a74487@SDF.ORG> <87dce3a4-9196-732f-8806-24c27e1772b2@ReliableID.com> In-Reply-To: From: Clout Tolstoy Date: Tue, 25 Jan 2022 11:44:22 -0800 Message-ID: Subject: Re: [9fans] Sponsoring a new Intro book by the Flan 9 Poundation To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary=00000000000078f6eb05d66d5048 Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 3b80631c-7e17-11ec-9019-ad34e3abbc00 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UNjI3YTI5YTdiYWJhZjI5ZS1NNjUwNzRlMWZkMTUxMzZlZGRhMDlk?= =?UTF-8?B?YWE1Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M65074e1fd15136edda09daa5:1:dEFwvawgbxS-L2TD0xbeKGkuxPaJqZ61O32ZMoKesrE --00000000000078f6eb05d66d5048 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable It's actually Mr. Tolstoy. Mr. Clout Tolstoy, and to be frank if you're not useful or have interest in helping, why waste your time? I have interest in helping if I can. What do you have to offer? Really? I have plenty of time to offer. On Tue, Jan 25, 2022 at 10:19 AM hiro <23hiro@gmail.com> wrote: > no regards at all. stop spamming mr. clout. > > On 1/25/22, Clout Tolstoy wrote: > > Yo! Work with them if you want to, don't work with them if you don't wa= nt > > to. > > So, please stop spamming the list with useless infos. Where are all the > > adults here? > > Most of you have posted NOTHING useful and probably feel proud of > yourself, > > perhaps angry at others? > > > > If you can't control what triggers you, maybe you shouldn't go out in > > public so freely? > > Or do some self-work, so what triggers you doesn't affect others. I for > > one, am happy > > for when people announce themselves as allies, or non-allies. Saves me > > time. > > > > adding "+1" is a joke of a comment and 10,000% useless data. STOP with = it > > please. > > You don't care about their opinions, why should others care about your > > stupid "+1"? > > > > The latest vandel is just an idiot with a keyboard, please don't be that > > person. > > > > I'm here to learn about Plan 9, C coding and hopefully find like minded > > people to > > do so with. EVeryone that has opposed this topic here is just a > > conserivtive snowflake > > melting with rage in the heat? Is that what I am understanding correctl= y? > > > > If this list isn't about how Plan9 can be the best it could ever be, > > especially with new > > people, then get off it please? > > > > Now, I'll go back to making popcorn, and watching all the snowflakes > piled > > up, melting > > away. Please stop being the oppressors of information. > > > > Cheers and my best regards! > > > > > > > > On Tue, Jan 25, 2022 at 4:29 AM Wes Kussmaul wrote: > > > >> On 1/25/22 03:58, hiro wrote: > >> >> A decade ago this list was still a pleasant space > >> > not really. but i guess you weren't around to truly experience it? > >> > haven't seen your name in older archives. > >> > >> Back then we had discordians disrupting things for sport. > >> > >> The latest vandal version is the social justice warrior. > >> > >> There will always be unhappy people who have a need to spread their > >> unhappiness. > >> > >> > Sorry Rux Cox, last reply. > >> > excellent. thanks for leaving after all. > >> > >> +1 > >> > >> -- > >> > >> *Wes Kussmaul* > >> > >> *Reliable Identities, Inc.* > >> an Authenticity Enterprise > >> 738 Main Street > >> Waltham, MA 02451 USA > >> t: +1 781 790 1674 > >> m: +1 781 330 1881 > >> e: wes@ReliableID.com > >> > >> Learn About Authenticity > >> > >> This message is confidential. It may also be privileged or otherwise > >> protected by work product immunity or other legal rules. If you have > >> received it by mistake, please let us know by e-mail reply and delete = it > >> from your system; you may not copy this message or disclose its conten= ts > >> to anyone. The integrity and security of this message cannot be assured > >> unless it is digitally signed by the PEN of an identity certificate wi= th > >> an IDQA score that is sufficient for your purposes. > >> ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T627a29a7babaf29e-M65074= e1fd15136edda09daa5 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --00000000000078f6eb05d66d5048 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
It's actually Mr. Tolstoy. Mr. C= lout Tolstoy, and to be frank if you're not useful or
have i= nterest in helping, why waste your time? I have interest in helping if I ca= n.

What do you have to offer? Really? I have plenty of ti= me to offer.

On Tue, Jan 25, 2022 at 10:19 AM hiro <23hiro@gmail.com> wrote:
no regards at all. stop spamming = mr. clout.

On 1/25/22, Clout Tolstoy <tolstoyclout@gmail.com> wrote:
> Yo! Work with them if you want to, don't work with them if you don= 't want
> to.
> So, please stop spamming the list with useless infos. Where are all th= e
> adults here?
> Most of you have posted NOTHING useful and probably feel proud of your= self,
> perhaps angry at others?
>
> If you can't control what triggers you, maybe you shouldn't go= out in
> public so freely?
> Or do some self-work, so what triggers you doesn't affect others.&= nbsp; I for
> one, am  happy
> for when people announce themselves as allies, or non-allies. Saves me=
> time.
>
> adding "+1" is a joke of a comment and 10,000% useless data.= STOP with it
> please.
> You don't care about their opinions, why should others care about = your
> stupid "+1"?
>
> The latest vandel is just an idiot with a keyboard, please don't b= e that
> person.
>
> I'm here to learn about Plan 9, C coding and hopefully find like m= inded
> people to
> do so with. EVeryone that has opposed this topic here is just a
> conserivtive snowflake
> melting with rage in the heat? Is that what I am understanding correct= ly?
>
> If this list isn't about how Plan9 can be the best it could ever b= e,
> especially with new
> people, then get off it please?
>
> Now, I'll go back to making popcorn, and watching all the snowflak= es piled
> up, melting
> away. Please  stop being the oppressors of information.
>
> Cheers and my best regards!
>
>
>
> On Tue, Jan 25, 2022 at 4:29 AM Wes Kussmaul <wes@reliableid.com> wrote:
>
>> On 1/25/22 03:58, hiro wrote:
>> >> A decade ago this list was still a pleasant space
>> > not really. but i guess you weren't around to truly exper= ience it?
>> > haven't seen your name in older archives.
>>
>> Back then we had discordians disrupting things for sport.
>>
>> The latest vandal version is the social justice warrior.
>>
>> There will always be unhappy people who have a need to spread thei= r
>> unhappiness.
>>
>> > Sorry Rux Cox, last reply.
>> > excellent. thanks for leaving after all.
>>
>> +1
>>
>> --
>>
>> *Wes Kussmaul*
>>
>> *Reliable Identities, Inc.*
>> an Authenticity Enterprise
>> 738 Main Street
>> Waltham, MA 02451 USA
>> t: +1 781 790 1674
>> m: +1 781 330 1881
>> e: wes@ReliableID.com
>>
>> Learn About Authenticity <https://whatisauthenticity.com/= >
>>
>> This message is confidential. It may also be privileged or otherwi= se
>> protected by work product immunity or other legal rules. If you ha= ve
>> received it by mistake, please let us know by e-mail reply and del= ete it
>> from your system; you may not copy this message or disclose its co= ntents
>> to anyone. The integrity and security of this message cannot be as= sured
>> unless it is digitally signed by the PEN of an identity certificat= e with
>> an IDQA score that is sufficient for your purposes.
>>

------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/T627a29a7babaf29e-M6b407194b8a9add43b76ff= 5a
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription
= --00000000000078f6eb05d66d5048--