From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 6145 invoked from network); 28 Sep 2022 21:58:02 -0000 Received: from tb-ob1.topicbox.com (64.147.108.173) by inbox.vuxu.org with ESMTPUTF8; 28 Sep 2022 21:58:02 -0000 Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob1.topicbox.com (Postfix) with ESMTP id 5B34720A85 for ; Wed, 28 Sep 2022 17:58:01 -0400 (EDT) (envelope-from bounce.mM783462abe28f6c80c7242850.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id 5350D4092730; Wed, 28 Sep 2022 17:58:01 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=azfB8Z6o header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=type9freak@gmail.com smtp.helo=mail-pf1-f179.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1664402280; bh=0dLqhoT+iMzaftvJ vEk01LMFl2eSG4wGi1VpA7RwGi0=; b=l6lkQO0bTZmZjo+z50muWur+OGHfxfpm zpRsO+2cfjJDTLfRraHWxJrRJ8rKnG+O33qBUp9gdx/OvSgCDbmH9F/V8DIDxWu4 jaAB18orBAnTFprATbMu8cnyJRd7nBZhIoZEK5TU6HZjzCXTBEWXbFj36RBHBMhG vVv4qLYqiGI= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1664402280; b=aJShu0xKcqhD8kUyR9cJ3Ovogf4haKMjNelESd2MZzEBf/zA83 So3RLFJbQaJhLRE7kppDwPR/WMemD/D+NXKIN++lLrH8yLwcmOy2F5KTwc9y8Tp4 jyj/MlM9Vr+hQNreVvOAuPDIlqIrly0GhkCYZTo09OLIScL3NHbSWGj6k= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=azfB8Z6o header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=type9freak@gmail.com smtp.helo=mail-pf1-f179.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (message has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=azfB8Z6o header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.210.179 (mail-pf1-f179.google.com); spf=pass smtp.mailfrom=type9freak@gmail.com smtp.helo=mail-pf1-f179.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=LwhXRqg1; x-me-sender=none; x-ptr=pass smtp.helo=mail-pf1-f179.google.com policy.ptr=mail-pf1-f179.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; t=1664402280; x=1664488680; bh=3Tcv1KAoN1pL9pb4TRsAm4Q51oMQlXIQ Fbys94rpjFw=; b=Z6MlJC+vMTt2J3fyHjEZbVEl1RE3zI/aF43boBLb+sjcAaPV vE4ykSroQwgB6ohS/CBIKTowfu+4jK2Ckd3ob3DYajsIGm2+wWYtvcCpyG/IOzPa 9/MzxlQ96cE0Q875FD1xF1pZuWfQzmn1tmyzoHSkifmxPKf+vFatPE/OhGE= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 7652017616DA for <9fans@9fans.net>; Wed, 28 Sep 2022 17:57:48 -0400 (EDT) (envelope-from type9freak@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 1DB6D805F46; Wed, 28 Sep 2022 17:57:48 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1664402268; b=yITsdNXWvVpV3a1Y8oMZAT6VfFQAiqOmBmnX+S48/p8D14qlh6 VHvJiDn/TyjMhQj7z8lfnoi97mCnscHqnriC6sRroXReMTQ13bioSUCtEknZKn0Q Hpex7iDCXLsuOTU/OpNQ2bX7ChPqkAqn4Hcu14J85raD6X7aIpwLrBv/RB0OseUg iycPzmHq25nXkoHLvu74draASNucuKWwoyhcEKcJA0pgHb46MU+EksdIC1o0j66P ZYxmGUj4k/c50YJAbyd4OEGWDFgS8mZ66GPNEZBY2CFcQ0r05TbXG6a4aAt7YSlx r8EgFEnsq6wmsL44R0RQVK8e2iUz/LgY4AiA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1664402268; bh=wLUgWTQOSeLWMaix0Bic14VIOBR5BnHQ7zhRBKQ0pJA=; b=qYBExHfRs+uY LZxLKlrEwN6sl/RZiH1ZMT1iVzlhrlHwTy8q5xOONhYTYkEHjKHpc9LWWQld8S8X nJks8CYmgU4es/rfeKithv95uFva8b0DqkTGw6wAeKaGqqG1rVWfnHifDAP9YZK3 Oy20vmnzr09UlGJcihf+NdIoVhnoIF2UA5LUBY3/5tEJTVUc8g1jLz1XlPug0WlX bvAFFMPTkcX2Li+U9ifvqVE1h8SCzqbRiVTA41e1L1ASpE332CErmSsDIPNXS2S4 ou+5Su8b0RlLXGEHmhq2+Le2vGjbR7bwrjOFWYBxWPJSVLOAkbTSHksuqpdvxs23 v5ZRrGTcBg== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=azfB8Z6o header.a=rsa-sha256 header.s=20210112 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.210.179 (mail-pf1-f179.google.com); spf=pass smtp.mailfrom=type9freak@gmail.com smtp.helo=mail-pf1-f179.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=LwhXRqg1; x-me-sender=none; x-ptr=pass smtp.helo=mail-pf1-f179.google.com policy.ptr=mail-pf1-f179.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvfedrfeegledgtdehucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf ffkffuvfgtsegrtderredttdejnecuhfhrohhmpehfihhguceothihphgvlehfrhgvrghk sehgmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeegieeggedvteeifefhheekle fhjeegjeduhefgveeikeevteeltdduhfffieelveenucffohhmrghinheplehprdiiohhn vgdpthhophhitggsohigrdgtohhmnecukfhppedvtdelrdekhedrvddutddrudejleenuc evlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvtdelrdekhedrvddu tddrudejledphhgvlhhopehmrghilhdqphhfuddqfhdujeelrdhgohhoghhlvgdrtghomh dpmhgrihhlfhhrohhmpeeothihphgvlehfrhgvrghksehgmhgrihhlrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'type9freak@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="type9freak@gmail.com"; helo=mail-pf1-f179.google.com; client-ip=209.85.210.179 Received: from mail-pf1-f179.google.com (mail-pf1-f179.google.com [209.85.210.179]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Wed, 28 Sep 2022 17:57:47 -0400 (EDT) (envelope-from type9freak@gmail.com) Received: by mail-pf1-f179.google.com with SMTP id 9so13637439pfz.12 for <9fans@9fans.net>; Wed, 28 Sep 2022 14:57:47 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :x-gm-message-state:from:to:cc:subject:date; bh=wLUgWTQOSeLWMaix0Bic14VIOBR5BnHQ7zhRBKQ0pJA=; b=LwhXRqg1ehZg9BiHAc1J7wS+XHhCveVLcRTQaF2GwqU1HHVcyuy7srV0nTCKqgdQbg 0ageI1vxXtXlHJmrd4Yw+CgPcdPIaDuS9Ff7srDveeKCM5AVb9O4DLSNr6Kl34hRZpMO ihAPhY3x+iywTj+HhhU34CuSdWbqIVioDCkDlJB3vlDCtUe0yMcBipIKvMJ+kvm3dfUp wcayLoYOMpzNUkeZHw9hnmRzkYePIdbxWF99m7U0JbdnbfPHaabUHLBl2GlxsmaOmyLE oUApa7StKlDaQQc8J9XNCCEoGxyt/uUEOQ5M/8qQ+bsMc2/Lb1H6YIw98FMxsgj+ii5a uASQ== X-Gm-Message-State: ACrzQf1SurcxwsLsEgNYzwxlOasimdykSjbbXpMKxm4c9HfJ7eUSyVbo ssGG630nkYYuLk8lAukYJqBDV/0fGlf/DxcYPEcnl+TBsCuxGg== X-Google-Smtp-Source: AMsMyM6Y+G5e4J2629xdS29BJvvKI2KEobHhJ3wMsG3qmmypfOdjU+6n8CTAP2dT/rFbn4VoHcPuTt3cDyNAgJBi6NM= X-Received: by 2002:a63:2a57:0:b0:439:42f4:97e1 with SMTP id q84-20020a632a57000000b0043942f497e1mr31136121pgq.190.1664402266384; Wed, 28 Sep 2022 14:57:46 -0700 (PDT) MIME-Version: 1.0 References: <16643179870.d6DDD.29535@composer.9fans.topicbox.com> <19860926-d1df-4b3e-9186-3e575408e56a@sirjofri.de> In-Reply-To: <19860926-d1df-4b3e-9186-3e575408e56a@sirjofri.de> From: fig Date: Wed, 28 Sep 2022 14:57:35 -0700 Message-ID: Subject: Re: [9fans] building a grid at university To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary=000000000000d9ee7d05e9c3d9da Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 99ff1e4c-3f78-11ed-bb4e-a083b15412eb Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UNzVkMjJhY2ZhNDc0YjIwOS1NNzgzNDYyYWJlMjhmNmM4MGM3MjQy?= =?UTF-8?B?ODUwPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M783462abe28f6c80c7242850:1:RNW1Q6E_AENIORsttRbwWHmvj45UvJzO__I45Dz8PZI --000000000000d9ee7d05e9c3d9da Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable > Think about what you want to do with those files on your server. i'm not going to needlessly elaborate, but i'll say that before this, i was already using my ebooks, audiobooks, text files and music with the tools from plan9port. > I recommend starting with a few servers (auth, fs, cpu, maybe even all in one machine) in the cloud, plus one local cpu server with a cache filesystem (cfs) for better latency. > Have your servers in the cloud. You're not a data center. VPS can be actually quite cheap, I pay 2.42 euro per month per machine. i think i have to, yeah. is there anything important to consider when choosing a VPS provider for plan 9 servers? or do they all play well? any recommendations are welcome. > on 9p.zone there's an extra service with a public auth service everybody can use for free. You could hook up your own fileserver to use this auth and control who has access to it. For shared projects on a shared system you can use the existing eu grid at 9p.zone (eu.9p.zone). this is a good resource to keep in mind. i was not aware of 9p.zone. another possibility: i could put plan 9 servers on a couple thinkpads and/or raspberry pis at my parents' house (not far from school) and have them connect to the 9p.zone auth server or a VPS of mine. the reason i did not initially list this as an option is because internet at home is pretty slow, and also i did not want to do any port forwarding at home. but this arrangement would not require any port forwarding, if i'm not mistaken. thanks for your reply. much appreciated. On Wed, Sep 28, 2022 at 12:03 AM sirjofri wrote: > Hello and welcome, > > 28.09.2022 00:33:32 type9freak@gmail.com: > > i want to have a server for my documents, ebooks, music, and images, as > well as a persistent IRC client and maybe even a mail server. > > Think about what you want to do with those files on your server. Do you > have an e-reader? A music player? A proper image viewer? Did you want to > stream these to other devices? How do you want to do that as most devices > don't support 9p? > > > most importantly, i want to be able to access the grid remotely: > > That's the more challenging part. I recommend starting with a few servers > (auth, fs, cpu, maybe even all in one machine) in the cloud, plus one loc= al > cpu server with a cache filesystem (cfs) for better latency. I have a > similar setup at home, but currently my local server has a full file > server, not only a cache. > > > from my laptop in class for example (same network) and maybe down the > line from anywhere, over internet. > > You have to check if your internet allows accessing remote services like > that. Some shared providers like universities block certain protocols, > ports and IP addresses. Maybe first test with 9p.zone or sdf bootcamp. > > > there are a number of things in the way of that, the first being my dorm > room does not have an ethernet outlet. i think mine is the only one on my > floor that doesn=E2=80=99t. second, my building loses power frequently, w= hich is > not ideal for hosting servers; power aside, it would still lose internet > connection. the third problem is less adverse, but the network requires > devices to be authenticated to get online. > > Have your servers in the cloud. You're not a data center. VPS can be > actually quite cheap, I pay 2.42 euro per month per machine. > > > does anyone see a favorable way to set up a plan 9 grid, either on > campus or an alternative? the biggest hurdle is definitely getting the gr= id > on the university network where it can be connected to locally, or getting > it out of the network and online. > > The probably only way to get something like you really want is to talk to > your university and maybe you can do a long term project with a small team > of other interested students (plus a prof). Depending on the University y= ou > might have luck, but the result is less ... personal. But you could also > add your own personal fileserver to that grid easier. > > > and i=E2=80=99m aware of 9gridchan >=20 > 9gridchan is mostly dead, and probably even more since a few months. Long > live 9gridchan, in 9p.zone. Both are actually targeted towards users, not > our beginners. >=20 > Note that on 9p.zone there's an extra service with a public auth service > everybody can use for free. You could hook up your own fileserver to use > this auth and control who has access to it. For shared projects on a shar= ed > system you can use the existing eu grid at 9p.zone (eu.9p.zone). >=20 > Disclaimer: I'm part of 9p.zone. >=20 > sirjofri >=20 > P.S for testing out grid stuff you can also try installing a grid in a > virtual machine network. ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T75d22acfa474b209-M78346= 2abe28f6c80c7242850 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --000000000000d9ee7d05e9c3d9da Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
> Think about what you want to do with thos= e files on your server. 
i'm not going to needlessly elaborate= , but i'll say that before this, i was already using my ebooks, audiobo= oks, text files and music with the tools from plan9port.

&g= t; I recommend starting with a few servers (auth, fs, cpu, maybe even all i= n one machine) in the cloud, plus one local cpu server with a cache filesys= tem (cfs) for better latency. 
> Have your servers in the clou= d. You're not a data center. VPS can be actually quite cheap, I pay 2.4= 2 euro per month per machine.
i think i have to, yeah. is there anythi= ng important to consider when choosing a VPS provider for plan 9 servers? o= r do they all play well?
any recommendations are welcome.
> on 9p.zone there's an extra service with a pub= lic auth service everybody can use for free. You could hook up your own fil= eserver to use this auth and control who has access to it. For shared proje= cts on a shared system you can use the existing eu grid at 9p.zone (eu.9p.z= one).
this is a good resource to keep in mind. i was not aware of= 9p.zone.

another possibility: i could put plan = 9 servers on a couple thinkpads and/or raspberry pis at my parents' hou= se (not far from school) and have them connect to the 9p.zone auth server o= r a VPS of mine. the reason i did not initially list this as an option is b= ecause internet at home is pretty slow, and also i did not want to do any p= ort forwarding at home. but this arrangement would not require any port for= warding, if i'm not mistaken.

thanks for you= r reply. much appreciated.

On Wed, Sep 28, 2022 at 12:03 AM sirjofri= <sirjofri+ml-9fans@s= irjofri.de> wrote:
Hello and welcome,

28.09.2022 00:33:32 type9freak@gmail.com:
> i want to have a server for my documents, ebooks, music, and images, a= s well as a persistent IRC client and maybe even a mail server.

Think about what you want to do with those files on your server. Do you hav= e an e-reader? A music player? A proper image viewer? Did you want to strea= m these to other devices? How do you want to do that as most devices don= 9;t support 9p?

> most importantly, i want to be able to access the grid remotely:
=
That's the more challenging part. I recommend starting with a few serve= rs (auth, fs, cpu, maybe even all in one machine) in the cloud, plus one lo= cal cpu server with a cache filesystem (cfs) for better latency. I have a s= imilar setup at home, but currently my local server has a full file server,= not only a cache.

> from my laptop in class for example (same network) and maybe down the = line from anywhere, over internet.

You have to check if your internet allows accessing remote services like th= at. Some shared providers like universities block certain protocols, ports = and IP addresses. Maybe first test with 9p.zone or sdf bootcamp.

> there are a number of things in the way of that, the first being my do= rm room does not have an ethernet outlet. i think mine is the only one on m= y floor that doesn’t. second, my building loses power frequently, whi= ch is not ideal for hosting servers; power aside, it would still lose inter= net connection. the third problem is less adverse, but the network requires= devices to be authenticated to get online.

Have your servers in the cloud. You're not a data center. VPS can be ac= tually quite cheap, I pay 2.42 euro per month per machine.

> does anyone see a favorable way to set up a plan 9 grid, either on cam= pus or an alternative? the biggest hurdle is definitely getting the grid on= the university network where it can be connected to locally, or getting it= out of the network and online.

The probably only way to get something like you really want is to talk to y= our university and maybe you can do a long term project with a small team o= f other interested students (plus a prof). Depending on the University you = might have luck, but the result is less ... personal. But you could also ad= d your own personal fileserver to that grid easier.

> and i’m aware of 9gridchan

9gridchan is mostly dead, and probably even more since a few months. Long l= ive 9gridchan, in 9p.zone. Both are actually targeted towards users, not ou= r beginners.

Note that on 9p.zone there's an extra service with a public auth servic= e everybody can use for free. You could hook up your own fileserver to use = this auth and control who has access to it. For shared projects on a shared= system you can use the existing eu grid at 9p.zone (eu.9p.zone).

Disclaimer: I'm part of 9p.zone.

sirjofri

P.S for testing out grid stuff you can also try installing a grid in a virt= ual machine network.

------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/T75d22acfa474b209-M425c6fd7a3e82dd78ebc97= 30
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription
= --000000000000d9ee7d05e9c3d9da--