From mboxrd@z Thu Jan 1 00:00:00 1970 X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-1.0 required=5.0 tests=DKIM_ADSP_CUSTOM_MED, DKIM_SIGNED,DKIM_VALID,FREEMAIL_FROM,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_MSPIKE_H2 autolearn=ham autolearn_force=no version=3.4.4 Received: (qmail 14491 invoked from network); 22 Aug 2021 12:24:46 -0000 Received: from tb-ob21.topicbox.com (173.228.157.67) by inbox.vuxu.org with ESMTPUTF8; 22 Aug 2021 12:24:46 -0000 Received: from tb-mx1.topicbox.com (tb-mx1.nyi.icgroup.com [10.90.30.61]) by tb-ob21.topicbox.com (Postfix) with ESMTP id 8CA8033993 for ; Sun, 22 Aug 2021 08:24:43 -0400 (EDT) (envelope-from bounce.mM2811fbdfd8c6710bf58ff059.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx1.topicbox.com (Postfix, from userid 1132) id 4DA7EFF20E1; Sun, 22 Aug 2021 08:24:43 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=PhqNrgZT header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=newton688@gmail.com smtp.helo=mail-qk1-f181.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type:list-help:list-id:list-post :list-subscribe:reply-to:content-transfer-encoding :list-unsubscribe; s=sysmsg-1; t=1629635083; bh=H8DCamsPOwbzqds7 i4pESjdh6K18+Xd+QOUOl95boqs=; b=H7MOQvgqFHc0fKdoEwtbOo4cf1efS+SM nNC6lhXd+gMIjTl7g5dil81vx9yVWUg1gCqbZNBHNIMubeG90TbyBwUVkFq6aJN4 RTPDgzji/yIrkkAtWz0/SyBLSH9V72xE/3VOOJESoOQvALo5I8Dxr5ilMyOW5pJR GWOIPYp3Zks= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1629635083; b=AFK/EjV5b+v+1vbC5kPsyc5i9J839YgY3/uZ3agbn9F1Aaks3e /6j+kbEJzErtKVHMJX4lcpKB6GIvIU50EwQudJbI1HJH2H3l9PNYH0nxLg2E4iEr Smsr/CskbvnWInTfHBQQSuYv/Tbz38Vv0iBVMbT6+9TnSE+tNTDCXZdlw= Authentication-Results: topicbox.com; arc=pass; dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=PhqNrgZT header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; spf=pass smtp.mailfrom=newton688@gmail.com smtp.helo=mail-qk1-f181.google.com; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=PhqNrgZT header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.222.181 (mail-qk1-f181.google.com); spf=pass smtp.mailfrom=newton688@gmail.com smtp.helo=mail-qk1-f181.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=pNZTYjOb; x-me-sender=none; x-ptr=pass smtp.helo=mail-qk1-f181.google.com policy.ptr=mail-qk1-f181.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h= mime-version:references:in-reply-to:from:date:message-id:subject :to:content-type:list-help:list-id:list-post:list-subscribe :reply-to:content-transfer-encoding:list-unsubscribe; s=dkim-1; bh=CywHUSTivS/oUIeax8E2y3TsM/0Pf318jM8poi3I1j0=; b=SCdV7eyGkSmr fx/GZyAFHmalNi3QansV2Eikm6W+O2HmdsvYC1EjAKu9Hn+YdKoAsEz7D2ptYizO X34PQ8+x7tvo4twDryCu32aXtNA7chyUqpbrNumQqC+YRE/d4p3LCmOX7VU/3o4o xjNy+d5G7OREjwt6Pken/BPZyruHXbk= Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 15536FF1CCA for <9fans@9fans.net>; Sun, 22 Aug 2021 08:24:34 -0400 (EDT) (envelope-from newton688@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 1418EE68D12; Sun, 22 Aug 2021 08:24:34 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1629635074; b=uaYFFsd38azRBajrxzf6qGIH2BVWjuyeD3Sdld/rudtInckw4G zaQDqQ3OzFn3TImIzlQVHzaocmyC4Vet8AYX1624xo4DGzW1/uPUEG4LIdo/clOQ 18Kl2jyL8TT1BBJnPyx2anak3nLV2v9S4mX+je/g4RPrIpu+2XtiUzfeIgi1I/vB LzsWTe23OkstGyy0w1eUAD5lE9YC3SrtYAbMX7U+A+ERu9rCCk1uiUNN2V6BfnJn QJxchRDKoOklswfPL1t9WUgRfNoaAuBBLm9egdmzL9UpKgC8EwHNsP6KicYb5znj HuJV6OxJJad9b56uEnBdXD9uwBO1fONM3Sxw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1629635074; bh=YrTBQhpuySRCC+G6FqAL+Ba0F+HnntcSe3HKjh41XwI=; b=K74KapUmdErc gHsmExebMSk1yJMqzwh5ZHsVrugLGLXpTZJqoPWTNNQ1GUzLwbiS7nS1tDJes+eh 8J6a5FyirVODvF4qWz/4cWLvCW9XzlCMD1qul2Q2nqn8XAqSdC1ov9oXVpA5I6pZ 0MMwToxTtx9L08Ee3mXRVGBIFlmp5Va+Q8jQrQQxqD96jEB2Y6/7q2ZVGxZVioTf ddbcbCk9EQHDGUb6obgtEt6z94MyQ2fU8zZaK1SCJv2eVVcS550QyS3vKwOxNk82 8pVtcx22YVGfQC6FlckIixwGLQMt+abmDnNxAitw91myBlcYgnbpgHGEON64AzL3 VY996f31Mw== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=PhqNrgZT header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.222.181 (mail-qk1-f181.google.com); spf=pass smtp.mailfrom=newton688@gmail.com smtp.helo=mail-qk1-f181.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=pNZTYjOb; x-me-sender=none; x-ptr=pass smtp.helo=mail-qk1-f181.google.com policy.ptr=mail-qk1-f181.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt3.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=0 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvtddruddtfedghedvucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucenucfjughrpeggfhgjhf ffkffuvfgtsegrtderredttdejnecuhfhrohhmpeevhhhrihhsucfotgfivggvuceonhgv fihtohhnieekkeesghhmrghilhdrtghomheqnecuggftrfgrthhtvghrnhepleeileetie efueegleevffffudelkeeileegueehkeektedvgfevveevueetkefgnecuffhomhgrihhn pehtohhpihgtsghogidrtghomhenucfkphepvddtledrkeehrddvvddvrddukedunecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvvddv rddukedupdhhvghlohepmhgrihhlqdhqkhduqdhfudekuddrghhoohhglhgvrdgtohhmpd hmrghilhhfrhhomhepoehnvgifthhonheikeeksehgmhgrihhlrdgtohhmqe X-ME-VSScore: 0 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'newton688@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="newton688@gmail.com"; helo=mail-qk1-f181.google.com; client-ip=209.85.222.181 Received: from mail-qk1-f181.google.com (mail-qk1-f181.google.com [209.85.222.181]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Sun, 22 Aug 2021 08:24:33 -0400 (EDT) (envelope-from newton688@gmail.com) Received: by mail-qk1-f181.google.com with SMTP id t190so16207358qke.7 for <9fans@9fans.net>; Sun, 22 Aug 2021 05:24:33 -0700 (PDT) X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:references:in-reply-to:from:date :message-id:subject:to; bh=YrTBQhpuySRCC+G6FqAL+Ba0F+HnntcSe3HKjh41XwI=; b=pNZTYjOb70kn5g7EcaQoKcKju9Gq4LlaopYNiKiOLjs8eNZIVgufPnBAGP1Ae9JOQv sffVa87J8XX1/6ko1D6HAdlIOJT0RekUP1Ga87dB1wNBkembivO+PBxBnu1zGCqRsjXf UIgehQ7q9YFwO8CeOppgVrk52CretseAt0eo9H8fTiEfWqudxfZDsj4lks1IYQmVruIB P0iSnvUoTfzezZBhbPVF8fs2TmcLLnaBQbVIDvudGkl/ImnlY06mi9fOAV3CYQU5wAUA uDn53YRr8FA6OYbnJepwl7e3lNrnQchteh84tphXvrSIsi5iAbQAwEeCowiWSOdq1QYf Af4Q== X-Gm-Message-State: AOAM533NmjuuQE8OiKEFEdFJbPGpH0o+hse5HPNI9nJxQF6LBNhcRv/s /ujSWizgVypqYKukIqIAXgJcn7ozMZGk6yfRWbfAAFyQ X-Google-Smtp-Source: ABdhPJxjgSNM5RFvy+riYWRhxG4/omS0Z0DFwrDoyjwNZ6Tm3g0byw7FUU+5JoCnF2Uqp2SYzHOmbvEaeLd3PIWuT5Y= X-Received: by 2002:a37:483:: with SMTP id 125mr16852605qke.306.1629635072748; Sun, 22 Aug 2021 05:24:32 -0700 (PDT) MIME-Version: 1.0 References: <4fb3ad2e48e31b089705a85b1374de02@hera.eonet.ne.jp> <18d7f6cc-8e13-4229-9fe3-d9247a3153fc@sirjofri.de> <26f2d31b-da03-f2c5-dda0-e03436c26b84@fjrhome.net> In-Reply-To: From: Chris McGee Date: Sun, 22 Aug 2021 08:24:21 -0400 Message-ID: Subject: Re: [9fans] Drawterm GPU (was: Software philosophy) To: 9fans <9fans@9fans.net> Content-Type: multipart/alternative; boundary="0000000000009ff03905ca24fb3f" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: eb01ba1a-0343-11ec-ac56-c7cde081f3a3 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UNjVlYzY0YWRiNTEzNzg3NC1NMjgxMWZiZGZkOGM2NzEwYmY1OGZm?= =?UTF-8?B?MDU5Pg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> Content-Transfer-Encoding: 7bit List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:M2811fbdfd8c6710bf58ff059:1:Wk5NXyR_7_zvXBdTOLgrQQcNhs7fZKEKnqvndQteYEc --0000000000009ff03905ca24fb3f Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable I was thinking that another way to get access to GPU across other OSes, chipsets, etc. might be WebGL. I was going to try with one of the web frontend drawterms out there (maybe aiju's) would be a reasonable starting point to expose a gpufs and model how it would work such that someday it could be implemented directly with Plan 9 drivers in the Plan 9 way. On Sun, Aug 22, 2021 at 7:50 AM sirjofri wrote: > I should mention I thought about the layout of a GPUfs some time ago. I > just lack lots of knowledge about this, the gist was to write shader > (code or compiled?) into some files, also write image data and mesh data > to other files, abd reading results from other files. But as I said, I > lack lots of knowledge about how GPUs work and never wrote any OpenGL > code myself, only shader code. It always seemed like it's hundreds of > hundreds of lines of code to draw a triangle (which is the basic hello > world program). > > sirjofri > > 22.08.2021 12:04:41 Frank D. Engel, Jr. : > > > While not necessarily unwelcome as a possibility, I don't think > > GPU-based drawing/gaming is as relevant to this discussion (or as > > important of a goal for Plan 9 / 9front) as is GPU compute (GPGPU). > > > > The ability to leverage GPU resources across CPU servers for > > computation purposes would be of great benefit to the platform, and > > working out a driver interface by starting the process remotely via > > drawterm seems like a sensible step in that direction. > > > > On 8/22/21 3:07 AM, sirjofri wrote: > >> > >> 22.08.2021 05:16:42 Eli Cohen : > >>> deep learning is another interest of mine too. hardware support is a > >>> big deal for that... some kind of support for GPUs would be nice. > >>> people have discussed that for years... hardware drivers are > >>> difficult > >>> and important to do correctly! > >>> > >>> I always really liked the "XCPU" and drawterm type ideas of using > >>> other OSes for their existing strengths along with Plan 9. maybe > >>> drawterm could have a GPU device driver or something... that being > >>> said I have sometimes found it ends up surprisingly easier doing it > >>> all on Plan 9... > >> That's also something I thought about a few times already: drawterm > >> with GPU support. The only issue I see is, for realtime applications > >> like games the draw times would be network bound and thus pretty slow. > >> It would work for heavy GPU applications where almost no draw calls > >> will exist (no textures, very low poly meshes, ...), but for heavier > >> stuff we'd need to address that. > >> That's the benefit of a native driver: you could calculate the server > >> side (heavy CPU calculations) on a cpu server, the client/frontend > >> side (including draw calls) on a terminal and the pure graphics on the > >> GPU. > >> I'd still give the drawterm GPU a shot. Maybe I can set drawterm up > >> for compilation on my work PC (two GTX 1080Ti) and try figuring out > >> how to do all that stuff. However, I've never done graphics > >> applications on windows or somewhere else that uses OpenGL or DirectX > >> (I'd try OpenGL because portability), only written shaders so far. > >> I'll surely need some time (which is always rare as a game developer). > >> Btw I don't know the exact specifications for GPU usage for neural > >> networks. I assume it's all compute shaders? Maybe it's even a kinda > >> blackbox, put stuff in (draw call), read things out. I assume this can > >> work perfectly fine for draw times, depending on the data. > >> sirjofri ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/T65ec64adb5137874-M2811f= bdfd8c6710bf58ff059 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription --0000000000009ff03905ca24fb3f Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
I was thinking that another way to get access = to GPU across other OSes, chipsets, etc. might be WebGL. I was going to try= with one of the web frontend drawterms out there (maybe aiju's) would = be a reasonable starting point to expose a gpufs and model how it would wor= k such that someday it could be implemented directly with Plan 9 drivers in= the Plan 9 way.

On Sun, Aug 22, 2021 at 7:50 AM sirjofri <sirjofri+ml-9fans@sirjofri.de<= /a>> wrote:
I should mention I thought about the layout of a GPUfs some time ago. I just lack lots of knowledge about this, the gist was to write shader
(code or compiled?) into some files, also write image data and mesh data to other files, abd reading results from other files. But as I said, I
lack lots of knowledge about how GPUs work and never wrote any OpenGL
code myself, only shader code. It always seemed like it's hundreds of <= br /> hundreds of lines of code to draw a triangle (which is the basic hello
world program).

sirjofri

22.08.2021 12:04:41 Frank D. Engel, Jr. <
fde101@fjrhome.net>:

> While not necessarily unwelcome as a possibility, I don't think > GPU-based drawing/gaming is as relevant to this discussion (or as
> important of a goal for Plan 9 / 9front) as is GPU compute (GPGPU). >
> The ability to leverage GPU resources across CPU servers for
> computation purposes would be of great benefit to the platform, and > working out a driver interface by starting the process remotely via > drawterm seems like a sensible step in that direction.
>
> On 8/22/21 3:07 AM, sirjofri wrote:
>>
>> 22.08.2021 05:16:42 Eli Cohen <echoline@gmail.com>:
>>> deep learning is another interest of mine too. hardware suppor= t is a
>>> big deal for that... some kind of support for GPUs would be ni= ce.
>>> people have discussed that for years... hardware drivers are <= br /> >>> difficult
>>> and important to do correctly!
>>>
>>> I always really liked the "XCPU" and drawterm type i= deas of using
>>> other OSes for their existing strengths along with Plan 9. may= be
>>> drawterm could have a GPU device driver or something... that b= eing
>>> said I have sometimes found it ends up surprisingly easier doi= ng it
>>> all on Plan 9...
>> That's also something I thought about a few times already: dra= wterm
>> with GPU support. The only issue I see is, for realtime applicatio= ns
>> like games the draw times would be network bound and thus pretty s= low.
>> It would work for heavy GPU applications where almost no draw call= s
>> will exist (no textures, very low poly meshes, ...), but for heavi= er
>> stuff we'd need to address that.
>> That's the benefit of a native driver: you could calculate the= server
>> side (heavy CPU calculations) on a cpu server, the client/frontend=
>> side (including draw calls) on a terminal and the pure graphics on= the
>> GPU.
>> I'd still give the drawterm GPU a shot. Maybe I can set drawte= rm up
>> for compilation on my work PC (two GTX 1080Ti) and try figuring ou= t
>> how to do all that stuff. However, I've never done graphics >> applications on windows or somewhere else that uses OpenGL or Dire= ctX
>> (I'd try OpenGL because portability), only written shaders so = far.
>> I'll surely need some time (which is always rare as a game dev= eloper).
>> Btw I don't know the exact specifications for GPU usage for ne= ural
>> networks. I assume it's all compute shaders? Maybe it's ev= en a kinda
>> blackbox, put stuff in (draw call), read things out. I assume this= can
>> work perfectly fine for draw times, depending on the data.
>> sirjofri

------------------------------------------
9fans: 9fans
Permalink: https:= //9fans.topicbox.com/groups/9fans/T65ec64adb5137874-M5c847fafe65a91d8e47e9b= 63
Delivery options: https://9fans.topicbox.com/gro= ups/9fans/subscription
= --0000000000009ff03905ca24fb3f--