From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx1.topicbox.com (localhost.local [127.0.0.1]) by tb-mx1.topicbox.com (Postfix) with ESMTP id 1D4ED49110D7 for <9fans@9fans.net>; Tue, 14 Apr 2020 16:20:32 -0400 (EDT) (envelope-from newton688@gmail.com) Received: from tb-mx1.topicbox.com (localhost [127.0.0.1]) by tb-mx1.topicbox.com (Authentication Milter) with ESMTP id 09C2B946E57; Tue, 14 Apr 2020 16:20:32 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1586895632; b=iP1SNeAlTsWmLrkeElnyt/HbYcDR64REbFYCabDrdE8e07v7Gd wMVO1YZkOsKLF7wGSjOUd50grjAHZdNUs0TpD9PtROBT6zoxo40DR5NJUxdbvkxe 3c2Gbxc8GurB7fteAZYVU542J0HlHNTJcjeuPM2RDGZyFIN0ihSPyNUc4bIbClch NDaxyY6X2YcBIDR593Gwpp1cOa98Em1hJiydq8r2JvpgpPuxHgAYPD9wGXwulsdW p5bpMrqN+l3x3bZO6a9VYSy5MagAUBN+IpoQE+JDyW1pIT2gR1mc9U6g9ldV9vVd jSS16IQvAgj3kBfhbAAsdHUXN5WDo2wwr0bQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:from:date:message-id:subject:to :content-type; s=arcseal; t=1586895632; bh=ApHNO7zGDuVBe9J8t1T3O p3UVbFkmZgl1AAb1GcAvYM=; b=JPu292g6+Wy4rnUNRWByMXxnpuwgcysMepMlg bzZxgE0KiN8SQ/sAeV4IsOuOmamF4f7x/mj3YvaDkAEJafBK0HHp1gK3AMLYh6LC USBNEqLEsSmK0XWcG3X5DB8BnJHnEqLDOPJAKZAeXSwVw3ucyRFjRgrnH3ZLW6sQ NP2VzKtskiFX8YGZYml3uZQiHeLuu+GIK9NTDYL0W2h301p31W6MEUB07/ml7jwc Hdq8REnMnUSFyH9ze3D7/4PvBZafpG8SgRU9kQ8WIfQEAMdY6X5/6tPtyCstivJo 29rrnz+zJ/EXRLnntbiLjFqjyY4suuZlVMG2QfRQorvRtJz8w== ARC-Authentication-Results: i=1; tb-mx1.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=vRSm9djv header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.53 (mail-vs1-f53.google.com); spf=pass smtp.mailfrom=newton688@gmail.com smtp.helo=mail-vs1-f53.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=F0af4Rt4; x-ptr=pass smtp.helo=mail-vs1-f53.google.com policy.ptr=mail-vs1-f53.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-100 state=0 Authentication-Results: tb-mx1.topicbox.com; arc=none (no signatures found); bimi=none (Domain is not BIMI enabled); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=vRSm9djv header.a=rsa-sha256 header.s=20161025 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.217.53 (mail-vs1-f53.google.com); spf=pass smtp.mailfrom=newton688@gmail.com smtp.helo=mail-vs1-f53.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=F0af4Rt4; x-ptr=pass smtp.helo=mail-vs1-f53.google.com policy.ptr=mail-vs1-f53.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-100 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduhedrfedugddugeekucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepggfhfffkuffvtgesrgdtreertddtjeenucfhrhho mhepvehhrhhishcuofgtifgvvgcuoehnvgifthhonheikeeksehgmhgrihhlrdgtohhmqe enucffohhmrghinhepphhinhgvieegrdhorhhgnecukfhppedvtdelrdekhedrvddujedr heefnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrke ehrddvudejrdehfedphhgvlhhopehmrghilhdqvhhsuddqfhehfedrghhoohhglhgvrdgt ohhmpdhmrghilhhfrhhomhepoehnvgifthhonheikeeksehgmhgrihhlrdgtohhmqecuuf fkkgfgpeeijeehle X-ME-VSScore: -100 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'newton688@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx1.topicbox.com; identity=mailfrom; envelope-from="newton688@gmail.com"; helo=mail-vs1-f53.google.com; client-ip=209.85.217.53 Received: from mail-vs1-f53.google.com (mail-vs1-f53.google.com [209.85.217.53]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx1.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Tue, 14 Apr 2020 16:20:31 -0400 (EDT) (envelope-from newton688@gmail.com) Received: by mail-vs1-f53.google.com with SMTP id g24so827899vsp.8 for <9fans@9fans.net>; Tue, 14 Apr 2020 13:20:31 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20161025; h=mime-version:from:date:message-id:subject:to; bh=ApHNO7zGDuVBe9J8t1T3Op3UVbFkmZgl1AAb1GcAvYM=; b=vRSm9djvgFXSsTrpQFeWAzAGVsbRQH0AV3eOawlcRTJhrMMOuXxER9QMiWd9BhBLOd 7fdZ6kpw6HCvAXA5/0rCmda2Q35uKOsNEW4k4DMh5Hnd5Qhx50J1joNcI8yY9hJxYg5Y 9GdHy71144+cjINs9Ym7/BhBYHjbgaSXfzRzRguC5I2/goWDvAWfzlYPgcyqFFthzPi8 WBYkXKX08AxtAWq1THAdfpFTZceRzJNbJ/tyD9sIudt2JM0z/gMzffhBOIfxnH/6TyPt dhjwI3id1xMHG68ue/XBEQZ4v8B8dE1ZNNs9awDKZDkrlBIMAMLj1A0s5as8Xw5muMW9 jp7w== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20161025; h=x-gm-message-state:mime-version:from:date:message-id:subject:to; bh=ApHNO7zGDuVBe9J8t1T3Op3UVbFkmZgl1AAb1GcAvYM=; b=F0af4Rt4LCoiheWhpxPzK7dzP9LKSeb/SkF5ZJKoh4+ZXlTJPKfkUZSoVzZZ0GQ6Yp IHtpsKUr1GREw/4AkTeIhxn5/Svx3ZAhaPVaYVcIwUT/z5oYelC4Z30zbD0vImg5m3Np rlinJOM/2DQfqRsF2m9rYP8SMu1QNh2/Qh0IrGHkeOHdy9/1uO6BteW7kfybvxhsUm6W VdQVkU+GZp4G7IN0aWbXJ7IoIV5p/ULQ+rPUAh3zuHABH7zMnVxmum3Mh2asxLQsFmBQ ymUTnxxUSOoGJvuwEuqGaqekGpYR2MINmZ5H6VER0XKi7S3CHRHJWOduZLXaTWYO93U/ oKzw== X-Gm-Message-State: AGi0Pua5pl/IkB/5M4nm7BHmCCC4+G9ta59ts81GEFGWq/zwJOi9uYuM /YHsQuOCcT7oQ6N2K829u+ao93Xhl55Rcmqlehcj9eF3umo= X-Google-Smtp-Source: APiQypL5CY9HKHvzOgof9INGGgqNlfc/MHM8ivxwsNSDxGv9DuTrcdoM+mpca106+oNNKztgznvSUnMYC53nV6jp2wk= X-Received: by 2002:a67:be18:: with SMTP id x24mr1821189vsq.29.1586895630684; Tue, 14 Apr 2020 13:20:30 -0700 (PDT) MIME-Version: 1.0 From: Chris McGee Date: Tue, 14 Apr 2020 16:20:19 -0400 Message-ID: Subject: Plan9 and Pine To: Fans of the OS Plan 9 from Bell Labs <9fans@9fans.net> Content-Type: multipart/alternative; boundary="0000000000005cd3f905a345ee95" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 66d4e5b4-7e8d-11ea-a1ea-8fdc3bb4f5e3 --0000000000005cd3f905a345ee95 Content-Type: text/plain; charset="UTF-8" Hello All, I'm not sure how many on here are aware of the Pine SBC's. There are a few different variants of those. Now there are even pre-built laptops and a phone. There is a plan for a tablet too. https://www.pine64.org/ >From what I can tell the hardware is well documented, inexpensive and well enough designed. There is a vibrant community that is currently working on porting different Linux flavours to the phone. Once things are stable the pine store will begin selling branded versions of the phone with the OS pre-installed and a portion of the profit going to the community to continue their work. Has anyone managed to port Plan 9 to these SBC's? Does anyone have an idea of how much work this would involve considering there's already 64-bit arm toolchain in place and raspberry pi working? Thinking longer term, might it be interesting or useful to this community to support some of this hardware, even if it was just the Allwinner SoC's, representing two of the SBC's lines, the original laptop, tablet and phone? I wonder for example if it might spark some more interest for people to try Plan 9 if they knew that there is a source of inexpensive and standardized hardware and things work mostly out of the box. I have some more far-fetched thoughts. Please, be gentle. :) Perhaps this is an opportunity for the Plan 9 community to think what it would mean to run in a phone form factor. From my experience with the different phone OSes, there's quite a bit of similarity (home screens, grids of "apps"). Maybe this can be done in more of a Plan 9 style, simpler, smaller, more composable and no teletypes (or X). If the community comes up with something then we have a hardware line capable of running it. If the system is compelling enough to outsiders and a partnership is established with the pine group then that might be an avenue to fund continuing improvements. And then, what about the tablet? Thanks for reading. Cheers, Chris --0000000000005cd3f905a345ee95 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
Hello All,

I'm not sure = how many on here are aware of the Pine SBC's. There are a few different= variants of those. Now there are even pre-built laptops and a phone. There= is a plan for a tablet too. https://ww= w.pine64.org/

From what I can tell the hardwar= e is well documented, inexpensive and well enough designed. There is a vibr= ant community that is currently working on porting different Linux flavours= to the phone. Once things are stable the pine store will begin selling bra= nded versions of the phone with the OS pre-installed and a portion of the p= rofit going to the community to continue their work.

Has anyone managed to port Plan 9 to these SBC's? Does anyone ha= ve an idea of how much work this would involve considering there's alre= ady 64-bit arm toolchain in place and raspberry pi working?
<= br>
Thinking longer term, might it be interesting or useful to th= is community to support some of this hardware, even if it was just the Allw= inner SoC's, representing two of the SBC's lines, the original lapt= op, tablet and phone? I wonder for example if it might spark some more inte= rest for people to try Plan 9 if they knew that there is a source of inexpe= nsive and standardized hardware and things work mostly out of the box.
<= /div>

I have some more far-fetched thoughts. Please, be = gentle. :)

Perhaps this is an opportunity for = the Plan 9 community to think what it would mean to run in a phone form fac= tor. From my experience with the different phone OSes, there's quite a = bit of similarity (home screens, grids of "apps"). Maybe this can= be done in more of a Plan 9 style, simpler, smaller, more composable and n= o teletypes (or X). If the community comes up with something then we have a= hardware line capable of running it. If the system is compelling enough to= outsiders and a partnership is established with the pine group then that m= ight be an avenue to fund continuing improvements.

And then, what about the tablet?

Thanks for r= eading.

Cheers,
Chris
--0000000000005cd3f905a345ee95--