From mboxrd@z Thu Jan 1 00:00:00 1970 Return-Path: X-Spam-Checker-Version: SpamAssassin 3.4.4 (2020-01-24) on inbox.vuxu.org X-Spam-Level: X-Spam-Status: No, score=-0.8 required=5.0 tests=DKIM_SIGNED,DKIM_VALID, HEADER_FROM_DIFFERENT_DOMAINS,HTML_MESSAGE,MAILING_LIST_MULTI, RCVD_IN_DNSWL_NONE autolearn=ham autolearn_force=no version=3.4.4 Received: from tb-ob0.topicbox.com (tb-ob0.topicbox.com [64.147.108.117]) by inbox.vuxu.org (Postfix) with ESMTP id E930F24A37 for ; Fri, 10 May 2024 09:34:24 +0200 (CEST) Received: from tb-mx0.topicbox.com (tb-mx0.nyi.icgroup.com [10.90.30.73]) by tb-ob0.topicbox.com (Postfix) with ESMTP id F0F5A37A0F for ; Fri, 10 May 2024 03:34:22 -0400 (EDT) (envelope-from bounce.mMaeaf9691be6b9745cf419692.r522be890-2105-11eb-b15e-8d699134e1fa@9fans.bounce.topicbox.com) Received: by tb-mx0.topicbox.com (Postfix, from userid 1132) id EE906181BA3B; Fri, 10 May 2024 03:34:22 -0400 (EDT) ARC-Authentication-Results: i=2; topicbox.com; arc=pass; dkim=none (no signatures found); dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=frozenwolf.net; spf=pass smtp.mailfrom=lallero@frozenwolf.net smtp.helo=mail.servizi-web.net; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=date:from:to:subject:in-reply-to:references :message-id:mime-version:content-type:content-transfer-encoding :list-help:list-id:list-post:list-subscribe:reply-to :list-unsubscribe; s=sysmsg-1; t=1715326462; bh=Lu0pu3zB+tlYgWZv vqzmFkeuv1VX/gcA37OuXeFfqpY=; b=A1sWQVXBYLoUX+lfam52/afBKXfsvYXs ZZkO9oq2Jj6oyL6Pp/HDUs8tgfbu3hvrKSL9b+o2NZWZ8K6SZRFK6bFsZrdinGxv RR7RXl1BqTmy3sesU+opiI909hPNkG3xcnlaVx/yCn+3PA0oxalOu3BJKX1oN8i0 E0uxyXOo9Bc= ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=topicbox.com; s=sysmsg-1; t= 1715326462; b=t9+8fsGekHkb8oFT6LmU6oNI2Rmw+/EZwt5GsGxMiCRLoAfstU B1/fTQXDt/UWzOALht/8x8flzqzE6dAHyuDvXfkk27fXE06pLr77l8VAe2CczE+4 YMmHxJgXQa/IdXLg8SDlbrpFLmmZVJDerDZrS279aF41sEjm3s0X4KROA= Authentication-Results: topicbox.com; arc=pass; dkim=none (no signatures found); dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=frozenwolf.net; spf=pass smtp.mailfrom=lallero@frozenwolf.net smtp.helo=mail.servizi-web.net; x-internal-arc=fail (as.1.topicbox.com=pass, ams.1.topicbox.com=fail (body has been altered)) (Message modified while forwarding at Topicbox) X-Received-Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=none (no signatures found); dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=frozenwolf.net; iprev=pass smtp.remote-ip=91.134.147.188 (mail.servizi-web.net); spf=pass smtp.mailfrom=lallero@frozenwolf.net smtp.helo=mail.servizi-web.net; x-aligned-from=pass (Address match); x-me-sender=none; x-ptr=pass smtp.helo=mail.servizi-web.net policy.ptr=mail.servizi-web.net; x-return-mx=pass header.domain=frozenwolf.net policy.is_org=yes (MX Records found: mail.servizi-web.net); x-return-mx=pass smtp.domain=frozenwolf.net policy.is_org=yes (MX Records found: mail.servizi-web.net); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-100 state=0 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed; d=9fans.net; h=date:from :to:subject:in-reply-to:references:message-id:mime-version :content-type:content-transfer-encoding:list-help:list-id :list-post:list-subscribe:reply-to:list-unsubscribe; s=dkim-1; t=1715326462; x=1715412862; bh=M5nkxAPeK796BMtvbBcnG4QoGaPXUgfX mi+PHE09EHU=; b=DmVUtfWV0WkWw9IvSfLot0qJxZNuEyMctQQAhxLB+JHkkTsL 27TZxK0ggJqps6AKyd3DfXN0cmJM9SqRaNRYr3MUwEh9nMQVwAKphPQPX9TxPUSM yB9y/OdlAlUMQGyo3luq1cvivgJajo5zYv5ug/SzLAo8nCckTP/vi94U83c= Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id C5E7B181B60B for <9fans@9fans.net>; Fri, 10 May 2024 03:34:05 -0400 (EDT) (envelope-from lallero@frozenwolf.net) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id 87D622B9758; Fri, 10 May 2024 03:34:05 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1715326445; b=WI1tGDGac/XO+adgqwxMmi726ihvKU93DVKiVnzi+NL0THTHch I6re9u0ObCFqWv5x6kwQcAv8+rOIsorG9suJAClB0aJKCRICYQTjAJQCyPHqMSM1 sRqD17gZ3Z6fburOXh8/x1w1m82NOP+kZVqOsKMBhSTKEXP3oO2vjsoJgRHEa16v yn3m9Hwf9rIrdQb8H0T8PxWTWX+2m3NQPweSF9QDs7uAnQE9gXTx0K+I4MLzgYVH cfsfyHkIPLHb8J92NKIPb/GnFxGmPVUm2sgyIJoKR2l57UEwxqCXEUj2qn947eRm YvBN8WMLjPNgXmlNzRpGDCtOO6c92EvuKI3Q== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=date:from:to:subject:in-reply-to:references :message-id:mime-version:content-type:content-transfer-encoding; s=arcseal; t=1715326445; bh=lmMWxP/CJylDgP0bwnIB3Ktmu9fwerOJL2h sm6dmIxE=; b=DOxn4m+K5TY7yXZn329Gj7C4Zyll94dJ28MVO42EjIeS/l2V6/V BLOH9g7pWdh+PY6LW7TIxYN3gOLw2LZjK82xj7ELALTspMujqvtKVXqKfKgMVJv5 bLxboCxv16BICnEY3x/5ritCXdVVjkV9XzNzHh1dr+Lr1BvoN2L+WrSXDHqhoA/q t4AWXzBFn4e0qlpFc1yNyl4UOj9BAYvRmUElDpYl7T3ffYLtRVEhE2Nczsvj4uXL ae3TTJonRJixgzdGDsHILATwHePjvw3shaUeGq1ukBZuI4xxB0XFIsVNGIiButVs GCasrZHvcjhkPn6GRDjLgtVZSHSDe5s/q3g== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC did not pass); dkim=none (no signatures found); dmarc=none policy.published-domain-policy=none policy.applied-disposition=none policy.evaluated-disposition=none (p=none,d=none,d.eval=none) policy.policy-from=p header.from=frozenwolf.net; iprev=pass smtp.remote-ip=91.134.147.188 (mail.servizi-web.net); spf=pass smtp.mailfrom=lallero@frozenwolf.net smtp.helo=mail.servizi-web.net; x-aligned-from=pass (Address match); x-me-sender=none; x-ptr=pass smtp.helo=mail.servizi-web.net policy.ptr=mail.servizi-web.net; x-return-mx=pass header.domain=frozenwolf.net policy.is_org=yes (MX Records found: mail.servizi-web.net); x-return-mx=pass smtp.domain=frozenwolf.net policy.is_org=yes (MX Records found: mail.servizi-web.net); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-100 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgedvledrvdefjedgudekucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnecujfgurhepfffhvffufggjfhfkgggtgfesrgejmhertderjeen ucfhrhhomhepnfgrlhhlvghrohcuoehlrghllhgvrhhosehfrhhoiigvnhifohhlfhdrnh gvtheqnecuggftrfgrthhtvghrnhepveejgeevffeigeffjeejieejteelleevtdevieej kedutefhgfeijefhveetueevnecuffhomhgrihhnpehtohhpihgtsghogidrtghomhenuc fkphepledurddufeegrddugeejrddukeekpdduhedurdduledrvddvhedrvddtudenucev lhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeeluddrudefgedrudegje drudekkedphhgvlhhopehmrghilhdrshgvrhhvihiiihdqfigvsgdrnhgvthdpmhgrihhl fhhrohhmpeeolhgrlhhlvghrohesfhhrohiivghnfiholhhfrdhnvghtqedpnhgspghrtg hpthhtohepuddprhgtphhtthhopeeolehfrghnsheslehfrghnshdrnhgvtheq X-ME-VSScore: -100 X-ME-VSCategory: clean Received-SPF: pass (frozenwolf.net: 91.134.147.188 is authorized to use 'lallero@frozenwolf.net' in 'mfrom' identity (mechanism 'mx' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="lallero@frozenwolf.net"; helo=mail.servizi-web.net; client-ip=91.134.147.188 Received: from mail.servizi-web.net (mail.servizi-web.net [91.134.147.188]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for <9fans@9fans.net>; Fri, 10 May 2024 03:34:04 -0400 (EDT) (envelope-from lallero@frozenwolf.net) Received: from localhost (localhost [127.0.0.1]) by mail.servizi-web.net (Postfix) with ESMTP id 89ACED83344; Fri, 10 May 2024 09:34:03 +0200 (CEST) Received: from mail.servizi-web.net ([127.0.0.1]) by localhost (mail.servizi-web.net [127.0.0.1]) (amavisd-new, port 10032) with ESMTP id rinXlh0BA31u; Fri, 10 May 2024 09:34:01 +0200 (CEST) Received: from localhost (localhost [127.0.0.1]) by mail.servizi-web.net (Postfix) with ESMTP id 2550CD83345; Fri, 10 May 2024 09:34:01 +0200 (CEST) X-Virus-Scanned: amavisd-new at mail.servizi-web.net Received: from mail.servizi-web.net ([127.0.0.1]) by localhost (mail.servizi-web.net [127.0.0.1]) (amavisd-new, port 10026) with ESMTP id UdHA2gdkiOlI; Fri, 10 May 2024 09:34:01 +0200 (CEST) Received: from [127.0.0.1] (unknown [151.19.225.201]) by mail.servizi-web.net (Postfix) with ESMTPSA id 81475D83344; Fri, 10 May 2024 09:34:00 +0200 (CEST) Date: Fri, 10 May 2024 09:33:56 +0200 From: Lallero To: 9fans <9fans@9fans.net>, vic.thacker@fastmail.fm, leimy2k via 9fans <9fans@9fans.net> Subject: =?US-ASCII?Q?Re=3A_=5B9fans=5D_Balancing_Progress_an?= =?US-ASCII?Q?d_Accessibility_in_the_Plan_9_Com?= =?US-ASCII?Q?munity=2E__=28Was=3A__=5B9fans=5D_Interoper?= =?US-ASCII?Q?ating_between_9legacy_and_9front=29?= User-Agent: K-9 Mail for Android In-Reply-To: <528ac9a8-92be-43a3-b531-db09ce0d6cae@app.fastmail.com> References: <53b297f4-31d4-48fd-86f4-6b5c2393edc0@app.fastmail.com> <84aa1c7f-1f39-43eb-81a2-b73cc432196a@app.fastmail.com> <528ac9a8-92be-43a3-b531-db09ce0d6cae@app.fastmail.com> Message-ID: MIME-Version: 1.0 Content-Type: multipart/alternative; boundary=----PCLQZVUT31HSFTG9JQ0V8H98IHFC0R Content-Transfer-Encoding: 7bit Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: b208ef0c-0e9f-11ef-bcfb-14c2fc8b7b06 Archived-At: =?UTF-8?B?PGh0dHBzOi8vOWZhbnMudG9waWNib3guY29tL2dyb3Vwcy85?= =?UTF-8?B?ZmFucy9UY2YxMjhmYTk1NWI4YWFmYy1NYWVhZjk2OTFiZTZiOTc0NWNmNDE5?= =?UTF-8?B?NjkyPg==?= List-Help: List-Id: "9fans" <9fans.9fans.net> List-Post: List-Software: Topicbox v0 List-Subscribe: Precedence: list Reply-To: 9fans <9fans@9fans.net> List-Unsubscribe: , Topicbox-Delivery-ID: 2:9fans:437d30aa-c441-11e9-8a57-d036212d11b0:522be890-2105-11eb-b15e-8d699134e1fa:Maeaf9691be6b9745cf419692:1:JcZIVyCp1IuGDMtDsrniHBzl89QJ7V6BQxIIJc8f9vg ------PCLQZVUT31HSFTG9JQ0V8H98IHFC0R Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Is it just me noticing this is chatgpt? Il 10 maggio 2024 06:44:48 CEST, vic.thacker@fastmail.fm ha scritto: >Hi Hiro et al, > >I view Plan 9 4th Edition as a version that remains largely unchanged, ser= ving as a snapshot in time, while 9legacy represents an active, distinct di= stribution. Conversely, 9front is a fork that has evolved significantly fro= m Plan 9 4th Edition, making considerable advancements in recent years. > >I appreciate the push for modernization with 9front, but I also see value = in maintaining support for older versions like Plan 9 4th Edition and 9lega= cy. Living in Japan, I have access to inexpensive hardware=E2=80=94local c= omputer resellers often offer older computers for as little as 2,000 yen ea= ch (e.g. $12.85 USD). For about 8,000 yen, it is possible to set up a func= tional Plan 9 system. This isn=E2=80=99t about leading the charge with the= latest and greatest OS; it's about the joy of tinkering and making the mos= t of accessible resources. For hobbyists like myself, the ability to use a= nd experiment with older systems is invaluable. Maintaining some level of = support or compatibility in the community can enhance the inclusiveness and= experimental spirit that is fundamental to Plan 9=E2=80=99s ethos. > >Maintaining updates and compatibility between Plan 9 4th Edition, 9legacy,= and 9front can provide several benefits, especially in a diverse community= like that of Plan 9. Here are some of the key advantages: > >(1) Broader Hardware Support: By keeping Plan 9 4th Edition and 9legacy u= pdated, users who rely on older or less common hardware configurations that= may not be fully supported by 9front can still benefit from updates and im= provements. This is particularly useful in academic or hobbyist settings w= here newer hardware may not be readily available or economically feasible. > >(2) Incremental Upgrades: Some users may prefer an incremental approach t= o system upgrades rather than a complete switch to a newer version. Integra= ting changes from 9front into 9legacy and Plan 9 4th Edition allows these u= sers to benefit from specific enhancements without the need to overhaul the= ir entire system setup. > >(3) Community Engagement: Keeping these versions updated helps engage dif= ferent segments of the Plan 9 community. It acknowledges the needs and pre= ferences of those who might prefer the familiarity of 9legacy or Plan 9 4th= Edition, fostering a more inclusive and vibrant community. > >(4) Preservation of Educational and Historical Value: Plan 9 has signific= ant educational and historical importance in the field of operating systems= . Maintaining and updating older versions ensures that this legacy is pres= erved, allowing new generations of students and enthusiasts to learn from a= nd experiment with these systems. > >(5) Security and Stability: Regular updates can address security vulnerab= ilities and fix bugs across all versions, ensuring that even older deployme= nts remain secure and stable. This is crucial for maintaining the integrit= y and usability of the systems over time. > >(6) Customization: Some users or organizations might have customized thei= r systems based on older versions of Plan 9. Keeping these systems updated= with changes from 9front can provide a path for these custom setups to rec= eive new features and improvements while maintaining their unique configura= tions. > >Overall, the integration of updates across different versions of Plan 9 ca= n help keep the system modern, secure, and accessible to a wide range of us= ers, enhancing both its utility and appeal. > >In embracing both the new and preserving the old, we not only honor the ri= ch legacy of Plan 9 but also ensure its relevance and accessibility for all= users, regardless of their hardware or specific needs. By updating 9legacy= and Plan 9 4th Edition alongside 9front, we foster a community that values= progress and innovation while respecting and supporting the diverse ways i= n which people interact with our beloved operating system. Together, let's = continue to build a welcoming and vibrant Plan 9 community that thrives on = both change and tradition. > >Kind regards, >Vester "Vic" Thacker > > >On Fri, May 10, 2024, at 04:50, hiro wrote: >> no clue which conflict you're seeing, vic. >> >> there's been some trolling back and forth since forever, there's been >> complaints and contributions, and more complaints about the >> contributions and the lack of contributions. as it should be. we can >> have one united community if you like but then i hope we still have >> those complaints. if no issues come up it just means that nobody used >> the system. >> >> personally i think non-dp9ik protocols should be removed completely or >> at the very least only allowed with very big fat warning messages. if >> 9legacy still doesn't have dp9ik, then why don't you just let 9legacy >> die? is there a single 9legacy-only improvement that's worth having in >> the first place? why does this discussion here even exist? if you want >> interoperability between things just upgrade everything to 9front. >> there's no more straightforward way, or? >> >> i know from linuxland where some garbage firmware or closed-source >> kernel driver prevents the use of newer linux releases, but i don't >> see similar problems in the 9front world at all. 9front provides a >> very steady and stable upgrade path i see no reason to keep an older >> plan9 4th edition system alive at all. what hardware does anybody have >> where 9front doesn't work but plan9 4th edition does?! >> --=20 Inviato dal mio dispositivo Android con K-9 Mail. Perdonate la brevit=C3=A0. ------------------------------------------ 9fans: 9fans Permalink: https://9fans.topicbox.com/groups/9fans/Tcf128fa955b8aafc-Maeaf9= 691be6b9745cf419692 Delivery options: https://9fans.topicbox.com/groups/9fans/subscription ------PCLQZVUT31HSFTG9JQ0V8H98IHFC0R Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable
Is it just me notici= ng this is chatgpt?


Il 10 maggio 2024 06:44:48 CEST, vic.thacker@fastmail.fm ha scritto:= 
Hi Hiro et al,

I view Plan 9 4th E=
dition as a version that remains largely unchanged, serving as a snapshot i=
n time, while 9legacy represents an active, distinct distribution. Converse=
ly, 9front is a fork that has evolved significantly from Plan 9 4th Edition=
, making considerable advancements in recent years.

I appreciate=
 the push for modernization with 9front, but I also see value in maintainin=
g support for older versions like Plan 9 4th Edition and 9legacy.  Living i=
n Japan, I have access to inexpensive hardware—local computer reselle=
rs often offer older computers for as little as 2,000 yen each (e.g. $12.85=
 USD).  For about 8,000 yen, it is possible to set up a functional Plan 9 s=
ystem.  This isn’t about leading the charge with the latest and great=
est OS; it's about the joy of tinkering and making the most of accessib=
le resources.  For hobbyists like myself, the ability to use and experiment=
 with older systems is invaluable.  Maintaining some level of support or co=
mpatibility in the community can enhance the inclusiveness and experimental=
 spirit that is fundamental to Plan 9’s ethos.

Maintaining=
 updates and compatibility between Plan 9 4th Edition, 9legacy, and 9front =
can provide several benefits, especially in a diverse community like that o=
f Plan 9.  Here are some of the key advantages:

(1) Broader Hard=
ware Support:  By keeping Plan 9 4th Edition and 9legacy updated, users who=
 rely on older or less common hardware configurations that may not be fully=
 supported by 9front can still benefit from updates and improvements.  This=
 is particularly useful in academic or hobbyist settings where newer hardwa=
re may not be readily available or economically feasible.

(2) In=
cremental Upgrades:  Some users may prefer an incremental approach to syste=
m upgrades rather than a complete switch to a newer version. Integrating ch=
anges from 9front into 9legacy and Plan 9 4th Edition allows these users to=
 benefit from specific enhancements without the need to overhaul their enti=
re system setup.

(3) Community Engagement:  Keeping these versio=
ns updated helps engage different segments of the Plan 9 community.  It ack=
nowledges the needs and preferences of those who might prefer the familiari=
ty of 9legacy or Plan 9 4th Edition, fostering a more inclusive and vibrant=
 community.

(4) Preservation of Educational and Historical Value=
:  Plan 9 has significant educational and historical importance in the fiel=
d of operating systems.  Maintaining and updating older versions ensures th=
at this legacy is preserved, allowing new generations of students and enthu=
siasts to learn from and experiment with these systems.

(5) Secu=
rity and Stability:  Regular updates can address security vulnerabilities a=
nd fix bugs across all versions, ensuring that even older deployments remai=
n secure and stable.  This is crucial for maintaining the integrity and usa=
bility of the systems over time.

(6) Customization:  Some users =
or organizations might have customized their systems based on older version=
s of Plan 9.  Keeping these systems updated with changes from 9front can pr=
ovide a path for these custom setups to receive new features and improvemen=
ts while maintaining their unique configurations.

Overall, the i=
ntegration of updates across different versions of Plan 9 can help keep the=
 system modern, secure, and accessible to a wide range of users, enhancing =
both its utility and appeal.

In embracing both the new and prese=
rving the old, we not only honor the rich legacy of Plan 9 but also ensure =
its relevance and accessibility for all users, regardless of their hardware=
 or specific needs. By updating 9legacy and Plan 9 4th Edition alongside 9f=
ront, we foster a community that values progress and innovation while respe=
cting and supporting the diverse ways in which people interact with our bel=
oved operating system. Together, let's continue to build a welcoming an=
d vibrant Plan 9 community that thrives on both change and tradition.
=

Kind regards,
Vester "Vic" Thacker


On=
 Fri, May 10, 2024, at 04:50, hiro wrote:
 no clue which conflict you'=
re seeing, vic.

 there's been some trolling back and forth s=
ince forever, there's been
 complaints and contributions, and more=
 complaints about the
 contributions and the lack of contributions. as=
 it should be. we can
 have one united community if you like but then =
i hope we still have
 those complaints. if no issues come up it just m=
eans that nobody used
 the system.

 personally i think non-=
dp9ik protocols should be removed completely or
 at the very least onl=
y allowed with very big fat warning messages. if
 9legacy still doesn&=
#39;t have dp9ik, then why don't you just let 9legacy
 die? is the=
re a single 9legacy-only improvement that's worth having in
 the f=
irst place? why does this discussion here even exist? if you want
 int=
eroperability between things just upgrade everything to 9front.
 there=
's no more straightforward way, or?

 i know from linuxland w=
here some garbage firmware or closed-source
 kernel driver prevents th=
e use of newer linux releases, but i don't
 see similar problems i=
n the 9front world at all. 9front provides a
 very steady and stable u=
pgrade path i see no reason to keep an older
 plan9 4th edition system=
 alive at all. what hardware does anybody have
 where 9front doesn'=
;t work but plan9 4th edition does?!

--
Inviato dal mio dispositivo Android con K-9 Mail. Perdon= ate la brevità.
= ------PCLQZVUT31HSFTG9JQ0V8H98IHFC0R--