From mboxrd@z Thu Jan 1 00:00:00 1970 Received: from tb-mx0.topicbox.com (localhost.local [127.0.0.1]) by tb-mx0.topicbox.com (Postfix) with ESMTP id 6282920DCF01 for ; Tue, 30 Jul 2024 13:06:16 -0400 (EDT) (envelope-from peter.tribble@gmail.com) Received: from tb-mx0.topicbox.com (localhost [127.0.0.1]) by tb-mx0.topicbox.com (Authentication Milter) with ESMTP id EC7AB4C60FF; Tue, 30 Jul 2024 13:06:16 -0400 ARC-Seal: i=1; a=rsa-sha256; cv=none; d=topicbox.com; s=arcseal; t= 1722359176; b=Sq+mxhaZ/YfVGsVBjASV06LMuZ/Kt+SxgPwvY6vSs5Dm6x5JZr NQg+EZC0GPT3AnkwIlKsWxv0FMWG54QUZovHOyVJVAHSS9hWW+cE65V2cO9Q5cDK cLF+Z54MW3whvJ7iJM7SFEZRpgHBWMUqez2+XvX6DA3egxn/PKxVEZAeRu5M9Xtd 1Km5yjtbu3semyJBAOOfRU1JxSJJmdbMFO/VWJI4HEXtEqj5SYflU+JbcZGgNtR1 IC+w4O9FunA8YwsNB3ZMpWUT8vw7mHv65pHdavR6oGVGAmzsGNxSER25v1KtiJj4 jNQ/GEb8CAJ7XL3GSud2kASSzRvknvNMW4+Q== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d= topicbox.com; h=mime-version:references:in-reply-to:from:date :message-id:subject:to:content-type; s=arcseal; t=1722359176; bh=zbxb3egLc50uybT8juup+/uvgASlmioomw4e1U9lJfs=; b=pShKsqUZIWwp cgkzqQCAcFbDupIMAWY51Xp+vtmeMMkff+aWPKlxRSzFIhr2+ui16vkdunaaTSGN XiSwyFsiIs6HGPeKBfeB1jrXtcapcam0g+vXw/iUWPRrmNemlbPvHOBxG1S9+jSG YA+0S0rfIapZhQBG/8XUrDn0W5AqcIGE//vnbSdd5g7M2UA9vUNSl61GZCc2lAOA x338vkSQnC9gaSctO6wjol0LJrNVW6tP7vT/l89mhWrvYG1xGxMuSYXjGysJ3Q0i G1wIwq8DpDX+x2v8CtzXXlNFAz3R7uo82RWMj3yz+fHZvSSMQDd9kLPZdaE7Y08t LVdRWxqa8g== ARC-Authentication-Results: i=1; tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=HP9Ar/w7 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.179 (mail-oi1-f179.google.com); spf=pass smtp.mailfrom=peter.tribble@gmail.com smtp.helo=mail-oi1-f179.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=etkraOi0; x-me-sender=none; x-ptr=pass smtp.helo=mail-oi1-f179.google.com policy.ptr=mail-oi1-f179.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-51 state=0 Authentication-Results: tb-mx0.topicbox.com; arc=none (no signatures found); bimi=skipped (DMARC Policy is not at enforcement); dkim=pass (2048-bit rsa key sha256) header.d=gmail.com header.i=@gmail.com header.b=HP9Ar/w7 header.a=rsa-sha256 header.s=20230601 x-bits=2048; dmarc=pass policy.published-domain-policy=none policy.published-subdomain-policy=quarantine policy.applied-disposition=none policy.evaluated-disposition=none (p=none,sp=quarantine,d=none,d.eval=none) policy.policy-from=p header.from=gmail.com; iprev=pass smtp.remote-ip=209.85.167.179 (mail-oi1-f179.google.com); spf=pass smtp.mailfrom=peter.tribble@gmail.com smtp.helo=mail-oi1-f179.google.com; x-aligned-from=pass (Address match); x-google-dkim=pass (2048-bit rsa key) header.d=1e100.net header.i=@1e100.net header.b=etkraOi0; x-me-sender=none; x-ptr=pass smtp.helo=mail-oi1-f179.google.com policy.ptr=mail-oi1-f179.google.com; x-return-mx=pass header.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-return-mx=pass smtp.domain=gmail.com policy.is_org=yes (MX Records found: alt3.gmail-smtp-in.l.google.com,alt1.gmail-smtp-in.l.google.com,gmail-smtp-in.l.google.com,alt4.gmail-smtp-in.l.google.com,alt2.gmail-smtp-in.l.google.com); x-tls=pass smtp.version=TLSv1.2 smtp.cipher=ECDHE-RSA-AES256-GCM-SHA384 smtp.bits=256/256; x-vs=clean score=-51 state=0 X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeeftddrjeeggdduuddtucetufdoteggodetrfdotf fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnh htshculddquddttddmnegoufhushhpvggtthffohhmrghinhculdegledmnecujfgurhep gghfjgfhfffkuffvtgesrgdtreertddtjeenucfhrhhomheprfgvthgvrhcuvfhrihgssg hlvgcuoehpvghtvghrrdhtrhhisggslhgvsehgmhgrihhlrdgtohhmqeenucggtffrrght thgvrhhnpeekudffvdfgkedvtdeukeeuhfefuedvhedvgeelgeektefhveegfeeitdffje dvheenucffohhmrghinhepuggsrdhithdpphgvthgvrhhtrhhisggslhgvrdgtohdruhhk pdgslhhoghhsphhothdrtghomhenucfkphepvddtledrkeehrdduieejrddujeelnecuve hluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrdduieej rddujeelpdhhvghlohepmhgrihhlqdhoihduqdhfudejledrghhoohhglhgvrdgtohhmpd hmrghilhhfrhhomhepoehpvghtvghrrdhtrhhisggslhgvsehgmhgrihhlrdgtohhmqedp nhgspghrtghpthhtohepuddprhgtphhtthhopeeoughishgtuhhssheslhhishhtshdrih hllhhumhhoshdrohhrgheq X-ME-VSScore: -51 X-ME-VSCategory: clean Received-SPF: pass (gmail.com ... _spf.google.com: Sender is authorized to use 'peter.tribble@gmail.com' in 'mfrom' identity (mechanism 'include:_netblocks.google.com' matched)) receiver=tb-mx0.topicbox.com; identity=mailfrom; envelope-from="peter.tribble@gmail.com"; helo=mail-oi1-f179.google.com; client-ip=209.85.167.179 Received: from mail-oi1-f179.google.com (mail-oi1-f179.google.com [209.85.167.179]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by tb-mx0.topicbox.com (Postfix) with ESMTPS for ; Tue, 30 Jul 2024 13:06:15 -0400 (EDT) (envelope-from peter.tribble@gmail.com) Received: by mail-oi1-f179.google.com with SMTP id 5614622812f47-3db1956643bso3024388b6e.3 for ; Tue, 30 Jul 2024 10:06:15 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20230601; t=1722359175; x=1722963975; darn=lists.illumos.org; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :from:to:cc:subject:date:message-id:reply-to; bh=zbxb3egLc50uybT8juup+/uvgASlmioomw4e1U9lJfs=; b=HP9Ar/w7JKNuoEdFVSg++HhYYDwBZGG315FOaD74J7sqPIM/6Q6cpgapahmyBb9ebU GhcJe+aDiO4ntAVsPhREpVLb37gD2Htmrjy2kKF90ajEPFETNndCOpDg/WF4zKiYPtXl JA6H8KzR5QtIWJ3Pw3QAjLhGJZWqCDoC0bckb8RWL5nOi0DFzQFYip+qOe1He+KTrxsi 04fx8R9xqdf+eI2gHoKMswIh7wAwBGK/HWhsKutLLZgGquc5qnDrsj+6BWXwCbamnTem pwoBWTNmtLrVeWiFAaZ8TI7NHPeSm3imyXZxO72Wv7z2oi0LWJAGodwUvwWuAgwMS8k/ 2Ezg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20230601; t=1722359175; x=1722963975; h=to:subject:message-id:date:from:in-reply-to:references:mime-version :x-gm-message-state:from:to:cc:subject:date:message-id:reply-to; bh=zbxb3egLc50uybT8juup+/uvgASlmioomw4e1U9lJfs=; b=etkraOi0XunNaMDOdxImzCrRMCt2J3h9+r4I72HNVJYCRAlDa4wrgvlmFpFIHzymQe bRHisbFJoQq408PZ1o02kP4fTwgL8En5mS/hd8YoTGl3UZ4skumICZsYEl6bMjG/UxU1 aJXlBP4OrCv5YMmZhWZk4qnN98xPmU++yfCyaq0oUwmjDMZpnpd6LdQycuxBAW9pdeBj DCsbilbI/wRMOa6ZIjN9dsmUCBHf5upIHKOEWnohbZ/WeUxNCHADNnzLZaqWLPWXr/FZ aT/QOLhtWrjyTPjBhJYxPIDfWFSNg1jVHyxwa1CkvxGH4UA0W3HG2J1upnXwknpw64Z1 7bxw== X-Gm-Message-State: AOJu0YysRMgDv5gVKTBG0TkbLyiJMcrmotxx9cgmJIOlpA94o7wuj0No +Vx9IzS/mnkwIoYl54cqW16eBrV4bQzmtPLFZBGqZOr+Wc8upUTU9z3kR0YoURhSzhUzzRuVflo UzaGSCffnakCVnYtTbaBhkhg6MilAU80= X-Google-Smtp-Source: AGHT+IFJfcbbmZSfQTWlV0sEFUwbi+WPB/N4A+9RB3Rons1Pr/I4phdyyyzydHfDLPLfpa8FBNR2IHiEMTSfzb7scAA= X-Received: by 2002:a05:6808:bca:b0:3d5:600c:682 with SMTP id 5614622812f47-3db23a67592mr13775270b6e.13.1722359174929; Tue, 30 Jul 2024 10:06:14 -0700 (PDT) MIME-Version: 1.0 References: <17222933330.24Ea622A.23229@composer.illumos.topicbox.com> <17222935480.D1d1A.177345@composer.illumos.topicbox.com> <17222940390.7FCBa.49150@composer.illumos.topicbox.com> In-Reply-To: <17222940390.7FCBa.49150@composer.illumos.topicbox.com> From: Peter Tribble Date: Tue, 30 Jul 2024 18:06:01 +0100 Message-ID: Subject: Re: [discuss] How much OpenIndiana is lagging behind Linux in live usb technology? To: illumos-discuss Content-Type: multipart/alternative; boundary="000000000000cc254e061e79fea5" Topicbox-Policy-Reasoning: allow: sender is a member Topicbox-Message-UUID: 0b6375a0-4e96-11ef-972c-7cfc088c7b06 --000000000000cc254e061e79fea5 Content-Type: text/plain; charset="UTF-8" Content-Transfer-Encoding: quoted-printable On Tue, Jul 30, 2024 at 12:00=E2=80=AFAM nsgnkhibdk2cls0f via illumos-discu= ss < discuss@lists.illumos.org> wrote: > Thank you for clarification. But the overall experience with OpenIndiana > live usb is still very bad. You should have a look at it and do something > to improve the performance. > Historically, OpenSolaris/OpenIndiana/Solaris, based on the Caiman installer, have typically taken about twice as long as Ubuntu (which is probably a fair comparison out of the available Linux distros). I did some comparisons back in OpenSolaris, and I don't know whether there's been significant change in that ratio. Certainly the recent Debian installs I've done have been horribly slow. While OmniOS and Tribblix are very very much quicker, I'm not entirely sure how much of that work translates directly to OpenIndiana - with different targets in mind we can optimize in very different directions, and both those distros wrote something from scratch. A couple of the things I have in my old notes last time I looked at this (I haven't done a regular OpenIndiana install for some years now): 1. As the live environment is absolutely static, certain things could be precalculated ahead of time. I think it has to calculate the lists of files to transfer, which seems wasteful to do each time. 2. One useful trick I do in Tribblix, again based on the notion that you know precisely what the install environment looks like, is to pregenerate the full SMF respository (by doing a test boot and saving off the repository.db. it's going to be the same every time) so as to avoid waiting for SMF import at first boot, which can save a bit [especially in some virtualized environments where manifest import seems to run abnormally slowly]. But one of the snags is that there isn't a great deal of understanding of the live boot and installer internals. Being a good perl programmer many decades ago gave me Laziness, Impatience, and Hubris, and after spending a few minutes trying to work out what Caiman was doing I decided it was too complicated for me so I wrote all the tools for Tribblix from scratch in a fraction of the time. --=20 -Peter Tribble http://www.petertribble.co.uk/ - http://ptribble.blogspot.com/ --000000000000cc254e061e79fea5 Content-Type: text/html; charset="UTF-8" Content-Transfer-Encoding: quoted-printable
On Tue, Jul 30, 2024 at 12:00=E2=80=AFAM = nsgnkhibdk2cls0f via illumos-discuss <discuss@lists.illumos.org> wrote:
Thank you for clarification. But the overall experience with Open= Indiana live usb is still very bad. You should have a look at it and do som= ething to improve the performance.

Historically, OpenSolaris/OpenIndiana/Solaris, based on the Caiman = installer, have
typically taken about twice as long as Ubuntu= (which is probably a fair comparison
out of the available Li= nux distros). I did some comparisons back in OpenSolaris, and
I don'= t know whether there's been significant change in that ratio. Certainly= the recent
Debian installs I've done have been horribly slow.
While OmniOS and Tribblix are very very much quicker, I'm = not entirely sure how much
of that work translates directly t= o OpenIndiana - with different targets in mind we can
optimiz= e in very different directions, and both those distros wrote something from= scratch.

A couple of the things I have in my old notes l= ast time I looked at this (I haven't
done a regular OpenI= ndiana install for some years now):

1. As the = live environment is absolutely static, certain things could be precalculate= d
ahead of time. I think it has to calculate the lists of fil= es to transfer, which seems
wasteful to do each time.

=
2. One useful trick I do in Tribblix, again based on the notion = that you know precisely
what the install environment looks li= ke, is to pregenerate the full SMF respository
(by doing a te= st boot and saving off the repository.db. it's going to be the same eve= ry
time) so as to avoid waiting for SMF import at first boot, which can = save a bit [especially
in some virtualized environments where manifest i= mport seems to run abnormally slowly].

But one of the sna= gs is that there isn't a great deal of understanding of the live
boot and installer internals. Being a good perl programmer many dec= ades ago
gave me Laziness, Impatience, and Hubris, and after = spending a few minutes
trying to work out what Caiman was doi= ng I decided it was too complicated
for me so I wrote all the tools for = Tribblix from scratch in a fraction of the time.

--
--000000000000cc254e061e79fea5--